gvim-9.0.2103-150500.20.6.1<>, e_H?d  +8<HLe P, j  $  t  & L  6 66TX](a8h9:!_>2@:BBF^GtHIlXYZx[\]H^@b cd0e5f8l:uLvwxy<zCgvim9.0.2103150500.20.6.1A GUI for ViPackage gvim contains the largest set of features of vim, which is graphical windows and language interpreter, like python, ruby, or perl. You need package vim for the help and other documentation too. If you want less features, you might want to install vim instead.e_Vimhttps://www.suse.com/Productivity/Text/Editorshttps://www.vim.org/linuxs390x/usr/sbin/update-alternatives \ --install /usr/bin/vim vim /usr/bin/gvim 30 \ --slave /usr/bin/vi vi /usr/bin/gvimif [ ! -e /usr/bin/gvim ] ; then /usr/sbin/update-alternatives --remove vim /usr/bin/gvim fiJr)U C.&F,A큤e_@V͛@V͛@VIV@V@VVŲ@V@V@VT@VV@V@V^VVuFVm]Vd#@VQ@VO @VCV VUU6@U@U@UnU@UUUx&U_@U>$U+UUQTT!TD@TfTr@T T TT|TTxcTk4T[bTBV@zbalogh@suse.comzbalogh@suse.comzbalogh@suse.comjehan.singh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comlnussel@suse.delnussel@suse.delnussel@suse.deidonmez@suse.comlnussel@suse.deidonmez@suse.comstefan.bruens@rwth-aachen.dekukuk@suse.delnussel@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comnormand@linux.vnet.ibm.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.commpluskal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comwerner@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comkukuk@suse.desuse-beta@cboltz.dekukuk@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comdimstar@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comcrrodriguez@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comlars@linux-schulserver.deidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.de- Updated to version 9.0 with patch level 2103, fixes the following security problems * Fixing bsc#1215940 (CVE-2023-5344) - VUL-0: CVE-2023-5344: vim: Heap-based Buffer Overflow in vim prior to 9.0.1969. * Fixing bsc#1216001 (CVE-2023-5441) - VUL-0: CVE-2023-5441: vim: segfault in exmode when redrawing * Fixing bsc#1216167 (CVE-2023-5535) - VUL-0: CVE-2023-5535: vim: use-after-free from buf_contents_changed() * Fixing bsc#1216696 (CVE-2023-46246) - VUL-0: CVE-2023-46246: vim: Integer Overflow in :history command * Fixing bsc#1214922 (CVE-2023-4738) - VUL-0: CVE-2023-4738: vim: heap-buffer-overflow in vim_regsub_both * Fixing bsc#1214924 (CVE-2023-4735) - VUL-0: CVE-2023-4735: vim: OOB Write ops.c * Fixing bsc#1214925 (CVE-2023-4734) - VUL-0: CVE-2023-4734: vim: segmentation fault in function f_fullcommand * Fixing bsc#1215004 (CVE-2023-4733) - VUL-0: CVE-2023-4733: vim: use-after-free in function buflist_altfpos * Fixing bsc#1215006 (CVE-2023-4752) - VUL-0: CVE-2023-4752: vim: Heap Use After Free in function ins_compl_get_exp * Fixing bsc#1215033 (CVE-2023-4781) - VUL-0: CVE-2023-4781: vim: heap-buffer-overflow in function vim_regsub_both - drop patches: disable-unreliable-tests.patch ignore-flaky-test-failure.patch vim-8.1.0297-dump3.patch - dropped %check - most of tests didn't work correctly in OBS and maintenance burden of this was getting too big - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1632...v9.0.2103- Use app icon generated from vimlogo.eps in source tarball; add higher res icons of sizes 128, 256, and 512px as png sources. Our current icons deviate from upstream flatpaks for example. - Updated to version 9.0 with patch level 1632 - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1443...v9.0.1632- Updated to version 9.0 with patch level 1572, fixes the following security problems * Fixing bsc#1210996 (CVE-2023-2426) - VUL-0: CVE-2023-2426: vim: Use of Out-of-range Pointer Offset in GitHub repository vim/vim prior to 9.0.1499. * Fixing bsc#1211256 (CVE-2023-2609) - VUL-1: CVE-2023-2609: vim: NULL Pointer Dereference prior to 9.0.1531 * Fixing bsc#1211257 (CVE-2023-2610) - VUL-1: CVE-2023-2610: vim: Integer Overflow or Wraparound prior to 9.0.1532 - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1443...v9.0.1572- Fixing bsc#1211461 - L3: vim "eats" first character from prompt in xterm * Add: reorder-exit-raw-mode.patch * Swaps out_str_t_TE() and cursor_on() during exit to prevent missing characters in xterm prompt on exit.- Fixing bsc#1211144 - [Build 96.1] openQA test fails in zypper_migration - conflict between xxd and vim * Revert the creation standalone xxd packages- Updated to version 9.0 with patch level 1443, fixes the following security problems * Fixing bsc#1209042 (CVE-2023-1264) - VUL-0: CVE-2023-1264: vim: NULL Pointer Dereference vim prior to 9.0.1392 * Fixing bsc#1209187 (CVE-2023-1355) - VUL-0: CVE-2023-1355: vim: NULL Pointer Dereference prior to 9.0.1402. * Fixing bsc#1208828 (CVE-2023-1127) - VUL-1: CVE-2023-1127: vim: divide by zero in scrolldown() - drop vim-8.0-ttytype-test.patch as it changes test_options.vim which we remove during %prep anyway. And this breaks quilt setup. - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1386...v9.0.1443- Updated to version 9.0 with patch level 1386, fixes the following security problems * Fixing bsc#1207780 - (CVE-2023-0512) VUL-0: CVE-2023-0512: vim: Divide By Zero in GitHub repository vim/vim prior to 9.0.1247 * Fixing bsc#1208957 - (CVE-2023-1175) VUL-0: CVE-2023-1175: vim: Incorrect Calculation of Buffer Size * Fixing bsc#1208959 - (CVE-2023-1170) VUL-0: CVE-2023-1170: vim: Heap-based Buffer Overflow in vim prior to 9.0.1376 * Fixing bsc#1208828 - (CVE-2023-1127) VUL-1: CVE-2023-1127: vim: divide by zero in scrolldown() - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1234...v9.0.1386- Updated to version 9.0 with patch level 1234, fixes the following security problems * Fixing bsc#1207396 VUL-0: CVE-2023-0433: vim: Heap-based Buffer Overflow in vim prior to 9.0.1225 * Fixing bsc#1207162 VUL-1: CVE-2023-0288: vim: Heap-based Buffer Overflow in GitHub repository vim/vim prior to 9.0.1189. * Fixing bsc#1206868 VUL-1: CVE-2023-0054: vim: Out-of-bounds Write in GitHub repository vim/vim prior to 9.0.1145. * Fixing bsc#1206867 VUL-1: CVE-2023-0051: vim: Heap-based Buffer Overflow in GitHub repository vim/vim prior to 9.0.1144. * Fixing bsc#1206866 VUL-1: CVE-2023-0049: vim: Out-of-bounds Read in GitHub repository vim/vim prior to 9.0.1143. - refreshed vim-7.4-highlight_fstab.patch - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1040...v9.0.1234- Updated to version 9.0 with patch level 1040, fixes the following security problems * Fixing bsc#1206028 VUL-0: CVE-2022-3491: vim: Heap-based Buffer Overflow prior to 9.0.0742 * Fixing bsc#1206071 VUL-0: CVE-2022-3520: vim: Heap-based Buffer Overflow * Fixing bsc#1206072 VUL-0: CVE-2022-3591: vim: Use After Free * Fixing bsc#1206075 VUL-0: CVE-2022-4292: vim: Use After Free in GitHub repository vim/vim prior to 9.0.0882. * Fixing bsc#1206077 VUL-0: CVE-2022-4293: vim: Floating Point Comparison with Incorrect Operator in GitHub repository vim/vim prior to 9.0.0804. * Fixing bsc#1205797 VUL-0: CVE-2022-4141: vim: heap-buffer-overflow in alloc.c 246:11 * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.814...v9.0.1040- Updated to version 9.0 with patch level 0814, fixes the following problems * Fixing bsc#1192478 VUL-1: CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow * Fixing bsc#1203508 VUL-0: CVE-2022-3234: vim: Heap-based Buffer Overflow prior to 9.0.0483. * Fixing bsc#1203509 VUL-1: CVE-2022-3235: vim: Use After Free in GitHub prior to 9.0.0490. * Fixing bsc#1203820 VUL-0: CVE-2022-3324: vim: Stack-based Buffer Overflow in prior to 9.0.0598. * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c * Fixing bsc#1203152 VUL-1: CVE-2022-2982: vim: use after free in qf_fill_buffer() * Fixing bsc#1203796 VUL-1: CVE-2022-3296: vim: stack out of bounds read in ex_finally() in ex_eval.c * Fixing bsc#1203797 VUL-1: CVE-2022-3297: vim: use-after-free in process_next_cpt_value() at insexpand.c * Fixing bsc#1203110 VUL-1: CVE-2022-3099: vim: Use After Free in ex_docmd.c * Fixing bsc#1203194 VUL-1: CVE-2022-3134: vim: use after free in do_tag() * Fixing bsc#1203272 VUL-1: CVE-2022-3153: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0404. * Fixing bsc#1203799 VUL-1: CVE-2022-3278: vim: NULL pointer dereference in eval_next_non_blank() in eval.c * Fixing bsc#1203924 VUL-1: CVE-2022-3352: vim: vim: use after free * Fixing bsc#1203155 VUL-1: CVE-2022-2980: vim: null pointer dereference in do_mouse() * Fixing bsc#1202962 VUL-1: CVE-2022-3037: vim: Use After Free in vim prior to 9.0.0321 - ignore-flaky-test-failure.patch: Ignore failure of flaky tests - disable-unreliable-tests-arch.patch: Removed - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.0313...v9.0.0814- Updated to version 9.0 with patch level 0313, fixes the following problems * Fixing bsc#1200884 Vim: Error on startup * Fixing bsc#1200902 VUL-0: CVE-2022-2183: vim: Out-of-bounds Read through get_lisp_indent() Mon 13:32 * Fixing bsc#1200903 VUL-0: CVE-2022-2182: vim: Heap-based Buffer Overflow through parse_cmd_address() Tue 08:37 * Fixing bsc#1200904 VUL-0: CVE-2022-2175: vim: Buffer Over-read through cmdline_insert_reg() Tue 08:37 * Fixing bsc#1201249 VUL-0: CVE-2022-2304: vim: stack buffer overflow in spell_dump_compl() * Fixing bsc#1201356 VUL-1: CVE-2022-2343: vim: Heap-based Buffer Overflow in GitHub repository vim prior to 9.0.0044 * Fixing bsc#1201359 VUL-1: CVE-2022-2344: vim: Another Heap-based Buffer Overflow vim prior to 9.0.0045 * Fixing bsc#1201363 VUL-1: CVE-2022-2345: vim: Use After Free in GitHub repository vim prior to 9.0.0046. * Fixing bsc#1201620 PUBLIC SUSE Linux Enterprise Server 15 SP4 Basesystem zbalogh@suse.com NEW --- SLE-15-SP4-Full-x86_64-GM-Media1 and vim-plugin-tlib-1.27-bp154.2.18.noarch issue * Fixing bsc#1202414 VUL-1: CVE-2022-2819: vim: Heap-based Buffer Overflow in compile_lock_unlock() * Fixing bsc#1202552 VUL-1: CVE-2022-2874: vim: NULL Pointer Dereference in generate_loadvar() * Fixing bsc#1200270 VUL-1: CVE-2022-1968: vim: use after free in utf_ptr2char * Fixing bsc#1200697 VUL-1: CVE-2022-2124: vim: out of bounds read in current_quote() * Fixing bsc#1200698 VUL-1: CVE-2022-2125: vim: out of bounds read in get_lisp_indent() * Fixing bsc#1200700 VUL-1: CVE-2022-2126: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1200701 VUL-1: CVE-2022-2129: vim: out of bounds write in vim_regsub_both() * Fixing bsc#1200732 VUL-1: CVE-2022-1720: vim: out of bounds read in grab_file_name() * Fixing bsc#1201132 VUL-1: CVE-2022-2264: vim: out of bounds read in inc() * Fixing bsc#1201133 VUL-1: CVE-2022-2284: vim: out of bounds read in utfc_ptr2len() * Fixing bsc#1201134 VUL-1: CVE-2022-2285: vim: negative size passed to memmove() due to integer overflow * Fixing bsc#1201135 VUL-1: CVE-2022-2286: vim: out of bounds read in ins_bytes() * Fixing bsc#1201136 VUL-1: CVE-2022-2287: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1201150 VUL-1: CVE-2022-2231: vim: null pointer dereference skipwhite() * Fixing bsc#1201151 VUL-1: CVE-2022-2210: vim: out of bounds read in ml_append_int() * Fixing bsc#1201152 VUL-1: CVE-2022-2208: vim: null pointer dereference in diff_check() * Fixing bsc#1201153 VUL-1: CVE-2022-2207: vim: out of bounds read in ins_bs() * Fixing bsc#1201154 VUL-1: CVE-2022-2257: vim: out of bounds read in msg_outtrans_special() * Fixing bsc#1201155 VUL-1: CVE-2022-2206: vim: out of bounds read in msg_outtrans_attr() * Fixing bsc#1201863 VUL-1: CVE-2022-2522: vim: out of bounds read via nested autocommand * Fixing bsc#1202046 VUL-1: CVE-2022-2571: vim: Heap-based Buffer Overflow related to ins_comp_get_next_word_or_line() * Fixing bsc#1202049 VUL-1: CVE-2022-2580: vim: Heap-based Buffer Overflow related to eval_string() * Fixing bsc#1202050 VUL-1: CVE-2022-2581: vim: Out-of-bounds Read related to cstrchr() * Fixing bsc#1202051 VUL-1: CVE-2022-2598: vim: Undefined Behavior for Input to API related to diff_mark_adjust_tp() and ex_diffgetput() * Fixing bsc#1202420 VUL-1: CVE-2022-2817: vim: Use After Free in f_assert_fails() * Fixing bsc#1202421 VUL-1: CVE-2022-2816: vim: Out-of-bounds Read in check_vim9_unlet() * Fixing bsc#1202511 VUL-1: CVE-2022-2862: vim: use-after-free in compile_nested_function() * Fixing bsc#1202512 VUL-1: CVE-2022-2849: vim: Invalid memory access related to mb_ptr2len() * Fixing bsc#1202515 VUL-1: CVE-2022-2845: vim: Buffer Over-read related to display_dollar() * Fixing bsc#1202599 VUL-1: CVE-2022-2889: vim: use-after-free in find_var_also_in_script() in evalvars.c * Fixing bsc#1202687 VUL-1: CVE-2022-2923: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0240 * Fixing bsc#1202689 VUL-1: CVE-2022-2946: vim: use after free in function vim_vsnprintf_typval * Fixing bsc#1202862 VUL-1: CVE-2022-3016: vim: Use After Free in vim prior to 9.0.0285 Mon 12:00- Deleted patches: * restrict-shell-commands.patch * source-check-sandbox.patch * vim-8.0.1568-CVE-2021-3778.patch * vim-8.0.1568-CVE-2021-3796.patch * vim-8.0.1568-CVE-2021-3872.patch * vim-8.0.1568-CVE-2021-3927.patch * vim-8.0.1568-CVE-2021-3928.patch * vim-8.0.1568-CVE-2021-3984.patch * vim-8.0.1568-CVE-2021-4019.patch * vim-8.0.1568-CVE-2021-4193.patch * vim-8.0.1568-CVE-2021-46059.patch * vim-8.0.1568-CVE-2022-0319.patch * vim-8.0.1568-CVE-2022-0351.patch * vim-8.0.1568-CVE-2022-0361.patch * vim-8.0.1568-CVE-2022-0413.patch * vim-8.0.1568-globalvimrc.patch - Added patches: * vim-8.1.0297-dump3.patch * vim-8.2.2411-globalvimrc.patch * disable-unreliable-tests-arch.patch - Updated patches: * disable-unreliable-tests.patch * vim-7.3-filetype_changes.patch * vim-7.3-filetype_ftl.patch * vim-7.3-filetype_spec.patch * vim-7.3-gvimrc_fontset.patch * vim-7.3-help_tags.patch * vim-7.3-mktemp_tutor.patch * vim-7.3-name_vimrc.patch * vim-7.3-sh_is_bash.patch * vim-7.3-use_awk.patch * vim-7.4-disable_lang_no.patch * vim-7.4-filetype_apparmor.patch * vim-7.4-filetype_mine.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch * vim-8.0.1568-defaults.patch * vim73-no-static-libpython.patch - Updated to version 8.2 with patch level 5038, fixes the following problems * Fixing bsc#1191770 VUL-0: CVE-2021-3875: vim: heap-based buffer overflow * Fixing bsc#1192167 VUL-0: CVE-2021-3903: vim: heap-based buffer overflow * Fixing bsc#1192902 VUL-0: CVE-2021-3968: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192903 VUL-0: CVE-2021-3973: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192904 VUL-0: CVE-2021-3974: vim: vim is vulnerable to Use After Free * Fixing bsc#1193466 VUL-1: CVE-2021-4069: vim: use-after-free in ex_open() in src/ex_docmd.c * Fixing bsc#1193905 VUL-0: CVE-2021-4136: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1194093 VUL-1: CVE-2021-4166: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1194216 VUL-1: CVE-2021-4193: vim: vulnerable to Out-of-bounds Read * Fixing bsc#1194217 VUL-0: CVE-2021-4192: vim: vulnerable to Use After Free * Fixing bsc#1194872 VUL-0: CVE-2022-0261: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1194885 VUL-0: CVE-2022-0213: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1195004 VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1195203 VUL-0: CVE-2022-0359: vim: heap-based buffer overflow in init_ccline() in ex_getln.c * Fixing bsc#1195354 VUL-0: CVE-2022-0407: vim: Heap-based Buffer Overflow in Conda vim prior to 8.2. * Fixing bsc#1198596 VUL-0: CVE-2022-1381: vim: global heap buffer overflow in skip_range * Fixing bsc#1199331 VUL-0: CVE-2022-1616: vim: Use after free in append_command * Fixing bsc#1199333 VUL-0: CVE-2022-1619: vim: Heap-based Buffer Overflow in function cmdline_erase_chars * Fixing bsc#1199334 VUL-0: CVE-2022-1620: vim: NULL Pointer Dereference in function vim_regexec_string * Fixing bsc#1199747 VUL-0: CVE-2022-1796: vim: Use After in find_pattern_in_path * Fixing bsc#1200010 VUL-0: CVE-2022-1897: vim: Out-of-bounds Write in vim * Fixing bsc#1200011 VUL-0: CVE-2022-1898: vim: Use After Free in vim prior to 8.2 * Fixing bsc#1200012 VUL-0: CVE-2022-1927: vim: Buffer Over-read in vim prior to 8.2 * Fixing bsc#1070955 VUL-1: CVE-2017-17087: vim: Sets the group ownership of a .swp file to the editor's primary group, which allows local users to obtain sensitive information * Fixing bsc#1194388 VUL-1: CVE-2022-0128: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1195332 VUL-1: CVE-2022-0392: vim: Heap-based Buffer Overflow in vim prior to 8.2 * Fixing bsc#1196361 VUL-1: CVE-2022-0696: vim: NULL Pointer Dereference in vim prior to 8.2 * Fixing bsc#1198748 VUL-1: CVE-2022-1420: vim: Out-of-range Pointer Offset * Fixing bsc#1199651 VUL-1: CVE-2022-1735: vim: heap buffer overflow * Fixing bsc#1199655 VUL-1: CVE-2022-1733: vim: Heap-based Buffer Overflow in cindent.c * Fixing bsc#1199693 VUL-1: CVE-2022-1771: vim: stack exhaustion in vim prior to 8.2. * Fixing bsc#1199745 VUL-1: CVE-2022-1785: vim: Out-of-bounds Write * Fixing bsc#1199936 VUL-1: CVE-2022-1851: vim: out of bounds read- Minimal fix for Bug 1195004 - (CVE-2022-0318) VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0413.patch - Fixing bsc#1190570 CVE-2021-3796: vim: use-after-free in nv_replace() in normal.c / vim-8.0.1568-CVE-2021-3796.patch - Fixing bsc#1191893 CVE-2021-3872: vim: heap-based buffer overflow in win_redr_status() drawscreen.c / vim-8.0.1568-CVE-2021-3872.patch - Fixing bsc#1192481 CVE-2021-3927: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-3927.patch - Fixing bsc#1192478 CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow / vim-8.0.1568-CVE-2021-3928.patch - Fixing bsc#1193294 CVE-2021-4019: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-4019.patch - Fixing bsc#1193298 CVE-2021-3984: vim: illegal memory access when C-indenting could lead to Heap Buffer Overflow / vim-8.0.1568-CVE-2021-3984.patch - Fixing bsc#1190533 CVE-2021-3778: vim: Heap-based Buffer Overflow in regexp_nfa.c / vim-8.0.1568-CVE-2021-3778.patch - Fixing bsc#1194216 CVE-2021-4193: vim: vulnerable to Out-of-bounds Read / vim-8.0.1568-CVE-2021-4193.patch - Fixing bsc#1194556 CVE-2021-46059: vim: A Pointer Dereference vulnerability exists in Vim 8.2.3883 via the vim_regexec_multi function at regexp.c, which causes a denial of service. / vim-8.0.1568-CVE-2021-46059.patch - Fixing bsc#1195066 CVE-2022-0319: vim: Out-of-bounds Read in vim/vim prior to 8.2. / vim-8.0.1568-CVE-2022-0319.patch - Fixing bsc#1195126 CVE-2022-0351: vim: uncontrolled recursion in eval7() / vim-8.0.1568-CVE-2022-0351.patch - Fixing bsc#1195202 CVE-2022-0361: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0361.patch - Fixing bsc#1195356 CVE-2022-0413: vim: use after free in src/ex_cmds.c / vim-8.0.1568-CVE-2022-0413.patch- install suse vimrc in /usr (boo#1182324, vim-8.0.1568-globalvimrc.patch)- source correct suse.vimrc file (boo#1182324)- stop owning /etc/vimrc so the old, distro provided config actually gets removed. Leaving it around leads to a duplicated autocmd for * .spec, leading to spec file template inserted twice. - own some dirs in vim-data-common so installation of vim-small doesn't leave not owned directories (boo#1173256). - Add vi as slave to update-alternatives so that every package has a matching "vi" symlink (bsc#1174564, boo#1176549).- Add restrict-shell-commands.patch to disable using interfaces in restricted mode, fixes bsc#1172225 CVE-2019-20807- introduce vim-small package with reduced requirements for small installations (boo#1166602). - BuildRequire pkg-config(krb5) instead of krb5-mini to be able to build against Tumbleweed repo.- Add source-check-sandbox.patch to fix CVE-2019-12735 boo#1137443- Pre-convert gvim icons, otherwise building vim depends on rsvg-convert -> librsvg -> cargo -> Rust -> LLVM - Cleanup SVG icon, make lines pixel-grid aligned - Correct RPM Group- Use %license instead of %doc [bsc#1082318]- instead of explicitly unsetting mouse, remove it from the defaults in the first place (boo#1079185, vim-8.0.1568-defaults.patch)- Switch to make -j1 clean to see if it fixes random build failures on Leap/SLE 15.- Updated to revision 1568, fixes the following problems * No test using a screen dump yet. * Screen dump test fails on MS-Windows. * Dead code found. * Assert_equalfile() does not close file descriptors. (Coverity) * Dump test fails when using a shadow directory. * Cannot use 24 bit colors in MS-Windows console. * Compiler warnings without termguicolors feature. * Libterm doesn't support requesting fg and bg color. * C syntax test fails when using gvim * C syntax test still fails when using gvim. * Quotestar test is flaky when using the GUI. * Xxd does not skip NUL lines when using ebcdic. * Popupmenu is too far left when completion is long. (Linwei) * No test for the popup menu positioning. * Popup menu positioning fails with longer string. * synpat_T is taking too much memory. * Terminal screen dump does not include cursor position. * With 'termguicolors' Normal color doesn't work correctly. * When using 'termguicolors' SpellBad doesn't show. * Screen dumps not included in distribution. * Using feedkeys() in a terminal window may trigger mappings. (Charles Sheridan) * Undo in the options window makes it empty. * Screen dump test script not included in distribution. * Various small problems in test files. * Various small problems in source files. * On Mac 'maxmemtot' is set to a weird value. * May leak file descriptors when executing job. * Cannot see what digraph is used to insert a character. * Custom plugins loaded with --clean. * Build error for some combination of features. * May not parse the t_RS response correctly, resulting in wrong characters in the input stream. * printf() does not work with only one argument. (Daniel Hahler) * No right-click menu in a terminal. * Build failure without GUI. * Build failure without GUI on MS-Windows. * Crash with rust syntax highligting. (Edd Barrett) * The terminal debugger can't set a breakpoint with the mouse. * Timeout of getwinposx() can be too short. (lilydjwg) * Too many #ifdefs. * Can't build Mac version without GUI. * Too many #ifdefs. * Cannot build Win32 GUI without IME. (John Marriott) * Can't build on older Mac, header file is missing.- Recommend vim-data so that colors can work by default- Updated to revision 1525, fixes the following problems * Compiler complains about uninitialized variable. (Tony Mechelynck) * Missing -D_FILE_OFFSET_BITS=64 may cause problems if a library is compiled with it. * Cannot act on edits in the command line. * Acessing freed memory after window command in auto command. (gy741) * Still too many old style tests. * Segmentation fault when Ruby throws an exception inside :rubyfile command. * Slow redrawing with DirectX. * Endless loop when gui_mch_stop_blink() is called while blink_state is BLINK_OFF. (zdohnal) * It is difficult to set the python home directory properly for Python 2.7 and 3.5 since both use $PYTHONHOME. * Terminal test fails on some systems. (jonathonf) * Terminal test fails on some slow terminals. * When in silent mode too much output is buffered. * If $SHELL contains a space then the default value of 'shell' is incorrect. (Matthew Horan) * Timer test on travis Mac is still flaky. * Clojure now supports a shebang line. * Filetype detection test does not check all scripts. * Cannot handle change of directory. * Missing file in patch. * Missing another file in patch. * Missing yet another file in patch. * Test fails without 'autochdir' option. * Completing directory after :find does not add slash. * Python2 and python3 detection not tested. (Matej Cepl) * Older GTK versions don't have gtk_entry_get_text_length(). * Libvterm doesn't handle illegal byte sequence correctly. * Illegal memory access in del_bytes(). * When package path is a symlink adding it to 'runtimepath' happens at the end. * Integer overflow when using regexp pattern. (geeknik) * On MS-Windows CursorIM highlighting no longer works. * MS-Windows: nsis installer is a bit slow. * MS-Windows: D&D fails between 32 and 64 bit apps. * Visual C 2017 has multiple MSVCVER numbers. * Invalid memory access in read_redo(). (gy741) * Screen isn't always updated right away. * Redraw flicker when moving the mouse outside of terminal window. * Unnecessary condition for "len" being zero. * Insert mode completion state is confusing. * Patch missing change. * Clearing a pointer takes two lines. * Using feedkeys() does not work to test Insert mode completion. (Lifepillar) * Searchpair() might return an invalid value on timeout. * Reduntant conditions. * Weird autocmd may cause arglist to be changed recursively. * Accessing invalid memory with "it". (Dominique Pelle) * Test 14 fails. * Emacs tags no longer work. (zdohnal) * There is no easy way to get the global directory, esp. if some windows have a local directory. * Number of spell regions is spread out through the code. * The minimum width of the popup menu is hard coded. * Memory leak in balloon_split(). * Completion items cannot be annotated. * No autocmd triggered in Insert mode with visible popup menu. * Having 'pumwidth' default to zero has no merit. * Clearing a pointer takes two lines. * Getting the jump list requires parsing the output of :jumps. * Getjumplist() returns duplicate entries. (lacygoill) * Out-of-memory situation not correctly handled. (Coverity) * Possible NULL pointer dereference. (Coverity) * Out-of-memory situation not correctly handled. (Coverity) * In out-of-memory situation character is not restored. (Coverity) * Access memory beyond end of string. (Coverity) * Win32: the screen may be cleared on startup. * Debugger can't break on a condition. (Charles Campbell) * New version of HP NonStop (Tandem) doesn't like the default header for setenv(). * Timer test is a bit flaky. * The :drop command is not always available. * Test for failing drag-n-drop command no longer fails. * Cannot test if a command causes a beep. * Some code for the debugger watch expression is clumsy. * Warning for possibly using NULL pointer. (Coverity) * The jumplist is not always properly cleaned up. * Getting the list of changes is not easy. * BufWinEnter event fired when opening hidden terminal. * Errors for job options are not very specific. * Invalid memory acces with pattern using look-behind match. (Dominique Pelle) * Error messages suppressed after ":silent! try". (Ben Reilly) * Getchangelist() does not use argument as bufname(). * Cursor is in the wrong line when using a WinBar in a Terminal window. * Shift-Tab does not work in a terminal window. * Popup menu is positioned in the wrong place. (Davit Samvelyan, Boris Staletic) * Cannot write and read terminal screendumps. * Compiler warnings for uninitialized variables. (Tony Mechelynck) * Using :wqa exits even if a job runs in a terminal window. (Jason Felice)- Split vim-data into vim-data-common package for low-disk usage scenarios bsc#1078722 bsc#1078554 bsc#1075541 - Make set mouse= default in suse.vimrc bsc#1079185 bsc#1078564 bsc#1067890 bsc#1064068 bsc#1062691- Updated to revision 1442, fixes the following problems * Crash when calling term_start() with empty argument. * Crash when term_start() fails. * MS-Windows: vimtutor fails if %TMP% has special chars. * After ":copen" can't get the window-ID of the quickfix window. (FalacerSelene) * Illegal memory access after undo. (Dominique Pelle) * GTK: :promtfind does not put focus on text input. (Adam Novak) * Memory leak in test_arabic. * Not enough information about what Python version may work. * Pkg-config doesn't work with cross compiling. * Filetype detection test not updated for change. * If cscope fails a search Vim may hang. * Terminal window: some vterm responses are delayed. * Using ":undo 0" leaves undo in wrong state. * Using pointer before it is set.- Make vim require vim-data bsc#1077352 bsc#1075541 bsc#1074790- Sort with spec-cleaner - Add conditional to build with python2 in order to build with py3 only enviroment - Convert dependencies to pkgconfig style- Updated to revision 1428, fixes the following problems * No test for expanding backticks. * Cursor column is not updated after ]s. (Gary Johnson) * Accessing freed memory in vimgrep. * Accessing invalid memory with overlong byte sequence. * No fallback to underline when undercurl is not set. (Ben Jackson) * Error in return not caught by try/catch. * The timer_pause test is flaky on Travis. * execute() does not work in completion of user command. (thinca) * "gf" and don't accept ? and & in URL. (Dmitrii Tcyganok) * The :leftabove modifier doesn't work for :copen. * Compiler warning on 64 bit MS-Windows system.- ignore make check transient errors for PowerPC bypass boo#1072651- Update apparmor.vim (taken from AppArmor 2.12) * add support for the "smc" network keyword- Updated to revision 1417, fixes the following problems * Encoding empty string to JSON sometimes gives "null". * Build fails with --with-features=huge --disable-channel. * Too much highlighting with 'hlsearch' and 'incsearch' set. * Cannot intercept a yank command. * It is not easy to see if a colorscheme is well written. * Memory leak when CTRL-G in search command line fails. * Pattern with \& following nothing gives an error. * :packadd does not load packages from the "start" directory. * Warnings and errors when building tiny version. (Tony Mechelynck) * Color scheme check script shows up as color scheme. * Cannot build with GTK but without XIM. (Guido) * Crash with nasty autocommand. (gy741, Dominique Pelle) * Using freed buffer in grep command. (gy741, Dominique Pelle) * Invalid memory access on exit when autocommands wipe out a buffer. * Duplicated code for getting a typed character. CursorHold is called too often in the GUI. (lilydjwg) * Difficult to track changes to a quickfix list. * GUI: CursorHold may trigger before 'updatetime' when using timers. * Crash in setqflist(). * Buffer overflow in :tags command. * Hang when using count() with an empty string. * Reading invalid memory with CTRL-W :. * Using free memory using setloclist(). (Dominique Pelle) * Accessing freed memory in :cbuffer. * Accessing freed memory in :lfile. * Warning for unused function without timers feature. * Crash when searching for a sentence. * Test doesn't search for a sentence. Still fails when searching for start of sentence. (Dominique Pelle)- Updated to revision 1390, fixes the following problems * Balloon shows when cursor is in WinBar. * terminal test hangs, executing abcde. (Stucki) * Cannot drag status line or vertical separator of new terminal window. (UncleBill) * MS-Windows: drawing underline, curl and strike-throw is slow, mFallbackDC not properly updated. * Channel test for callback is flaky. * Shift-Insert doesn't always work in MS-Windows console. * Profile log may be truncated halfway a character. * No error when settting 'renderoptions' to an invalid value before starting the GUI. * CTRL-A does not work with an empty line. (Alex) * Window size wrong after maximizing with WinBar. (Lifepillar) * Cursor in terminal not always updated. * Cannot call a dict function in autoloaded dict. * Autoload script sources itself when defining function. * Configure check for selinux does not check for header file. * When recovering a file with "vim -r swapfile" the hit-enter prompt is at the top of the window. * ch_readraw() waits for NL if channel mode is NL. * Get "no write since last change" message if a terminal is open. * Local additions in help skips some files. (joshklod) * Not enough quickfix help; confusing winid. * Python 3.5 is getting old. * Cannot select modified buffers with getbufinfo(). * Wordcount test is old style. * Char not overwritten with ambiguous width char, if the ambiguous char is single width but we reserve double-width space. * getqflist() items are missing if not set, that makes it more difficult to handle the values. * DirectX scrolling can be slow, vertical positioning is off.- Updated to revision 1365, fixes the following problems * Libvterm ANSI colors can not always be recognized from the RGB values. The default color is wrong when t_RB is empty. * The Terminal highlighting doesn't work in a terminal. * Some users don't want to diff with hidden buffers. * Terminal window colors wrong when using Terminal highlighting. * Recovering does not work when swap file ends in .stz. * There is no easy way to get the window position. * When one channel test fails others fail as well.- Update to revision 1358 * Too many changes to list - Fixes CVE-2017-1000382 bsc#1065958 - Refresh patches: * disable-unreliable-tests.patch * vim-7.3-filetype_spec.patch * vim-7.4-disable_lang_no.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch- Explicitly require python2-devel- Add disable-unreliable-tests.patch to disable unreliable tests bsc#1054723- Bump priorities so we can upgrade from 12.3- Updated to revision 627, fixes the following problems * Call for requesting color and ambiwidth is too early. (Hirohito Higashi) * "1gd" may hang. * Bracketed paste is still enabled when executing a shell command. (Michael Smith) * Can't run make with several jobs, creating directories has a race condition. * The cursor line number becomes negative when using :z^ in an empty buffer. (neovim #6557) * Building the command table requires Perl. * Running parallel make after distclean fails. (Manuel Ortega) * Get only one quickfix list after :caddbuf. * Using freed memory when resetting 'indentexpr' while evaluating it. (Dominique Pelle) * Can't build when configure choses "install-sh". (Daniel Hahler) * Warning for uninitialized variable. (John Marriott) * :simalt on MS-Windows does not work properly. * Duplicate test case for quickfix. * Cannot set the valid flag with setqflist(). * Moving folded text is sometimes not correct. * Illegal memory access with z= command. (Dominique Pelle) * Fold test hangs on MS-Windows. * Memory leak when executing quickfix tests. * Test_options fails when run in the GUI. * No test for mapping timing out. * Configure check for return value of tgetent is skipped. * job_stop() often assumes the channel will be closed, while the job may not actually be stopped. (Martin Gammelsæter) * :simalt still does not work. * Cannot add a context to locations. * Changes to eval functionality not documented. * If a job writes to a buffer and the user is typing a command, the screen isn't updated. When a message is displayed the changed buffer may cause it to be cleared. (Ramel Eshed) * Duplication of code for adding a list or dict return value. * Build failure when windows feature is missing. * Coverity warning for not checking return value of dict_add(). * Crash when complete() is called after complete_add() in 'completefunc'. (Lifepillar) * Off-by-one error in buffer size computation. * Building with gcc 7.1 yields new warnings. * diff mode is insufficiently tested * test_recover fails on some systems. * No test coverage for :spellrepall. * When gF fails to edit the file the cursor still moves to the found line number. * gF test fails on MS-Windows. * gF test fails still on MS-Windows. * The buffer that quickfix caches for performance may become invalid. (Daniel Hahler) * Cannot set the context for a specified quickfix list. * When creating a bufref, then using :bwipe and :new it might get the same memory and bufref_valid() returns true. * Cannot manipulate other than the current quickfix list. * For some people the hint about quitting is not sufficient. * The screen is redrawn when t_BG is set and used to detect the value for 'background'. * When t_u7 is sent a few characters in the second screen line are overwritten and not redrawn later. (Rastislav Barlik) * Package directories are added to 'runtimepath' only after loading non-package plugins. * The conf filetype detection is done before ftdetect scripts from packages that are added later. * float2nr() is not exactly right. * Using % with :hardcopy wrongly escapes spaces. (Alexey Muranov) * When setting the cterm background with ":hi Normal" the value of 'background' may be set wrongly. * Hardcopy test hangs on MS-Windows. * NFA regex engine handles [0-z] incorrectly. * In the GUI, when a timer uses feedkeys(), it still waits for an event. (Raymond Ko) * Since we only support GTK versions that have it, the ckeck for HAVE_GTK_MULTIHEAD is no longer needed. * The ":stag" command does not respect 'switchbuf'. * Using a text object to select quoted text fails when 'selection' is set to "exclusive". (Guraga) * The message "Invalid range" is used for multiple errors. * Warning for unused variable in tiny build. (Tony Mechelynck) * shellescape() always escapes a newline, which does not work with some shells. (Harm te Hennepe) * In the GUI the cursor may flicker. * When 'wrapscan' is off "gn" does not select the whole pattern when it's the last one in the text. (KeyboardFire)- Extend vimrc with mappings for 8-bit controls key escape sequences- Conflict with old vim versions to fix the upgrade from 12.3 boo#1036583- Updated to revision 566, fixes the following problems * :windo allows for ! but it's not supported. * Undefined behavior when using backslash after empty line. * Not enough test coverage for syntax commands. * Crash when getting the window position in tmux. * Cannot detect Bazel BUILD files on some systems. * Using freed memory in :caddbuf after clearing quickfix list. * Setting nocompatible for the tiny version moves the cursor. - Refresh and re-add vim-8.0-ttytype-test.patch- Updated to revision 559, fixes the following problems * Test_edit causes older xfce4-terminal to close. (Dominique Pelle) * Cppcheck warnings. * Edit test may fail on some systems. * Swap file exists briefly when opening the command window. * Extra line break in verbosefile when using ":echomsg". (Ingo Karkat) * Saving the redo buffer only works one time, resulting in the "." command not working well for a function call inside another function call. * No test for the 8g8 command. * Some etags format tags file use 0x01, breaking the parsing. * The typeahead buffer is reallocated too often. * Toupper and tolower don't work properly for Turkish when 'casemap' is empty. (Bjorn Linse) * Toupper/tolower test with Turkish locale fails on Mac. * Toupper and tolower don't work properly for Turkish when 'casemap' contains "keepascii". (Bjorn Linse) * Toupper/tolower test fails on OSX without Darwin. * Getting the window position fails if both the GUI and term code is built in. * GTK: using static gravities is not useful. * The :ownsyntax command is not tested. * Setting ttytype to xxx does not always fail as expected. - Remove vim-8.0-ttytype-test.patch, fixed upstream.- Update the update-alternatives code- Updated to revision 542, fixes the following problems * ml_get errors in silent Ex mode. (Dominique Pelle) * A large count on a normal command causes trouble. (Dominique Pelle) * There is no way to remove quickfix lists (for testing). * Storing a zero byte from a multi-byte character causes fold text to show up wrong. * Character classes are not well tested. They can differ between platforms. * Using a function pointer instead of the actual function, which we know. * GtkForm handling is outdated. * MS-Windows: when 'clipboard' is "unnamed" yyp does not work in a :global command. * dv} deletes part of a multi-byte character. (Urtica Dioica) * Folds are messed up when 'encodin' is "utf-8". * Coverity complains about possible negative value. * RISC OS support was removed long ago, but one file is still included. * When 'wildmenu' is set and 'wildmode' has "longest" then the first file name is highlighted, even though the text shows the longest match. * Line in test commented out. * Buffer overflow when 'columns' is very big. (Nikolai Pavlov) * Test with long directory name fails on non-unix systems. * Test with long directory name fails on Mac. * Abbreviation doesn't work after backspacing newline. (Hkonrk) * Defaults.vim does not work well with tiny features. (crd477) * Memory leak when exiting from within a user function. * Quickfix window not updated when freeing quickfix stack. * Illegal memory access with :z and large count. * No test for falling back to default term value. * Startup test fails on Mac. * Building unit tests fails. * Compiler warning on MS-Windows. * getpos() can return a negative line number. (haya14busa)- Update spec.skeleton with spec-cleaner- Updated to revision 514, fixes the following problems * Insufficient testing for statusline. * 'makeencoding' missing from the options window. * Git and hg see new files after running tests. (Manuel Ortega) * Options test does not always test everything. * Options test fails or hangs on MS-Windows. * 'cinoptions' cannot set indent for extern block. * "make shadow" creates an invalid link. * Quite a few beeps when running tests. * Clang version not correctly detected. * Some functions are not tested. * Running the options test sometimes resizes the terminal. * The packadd test does not create the symlink correctly and does not test the right thing. * The fnamemodify test changes 'shell' in a way later tests may not be able to use system(). * Using ":%argdel" while the argument list is already empty gives an error. (Pavol Juhas) * Not enough test coverage in Insert mode. * Dead code in #ifdef. * Patch shell command uses double quotes around the argument, which allows for $HOME to be expanded. (Etienne) * Terminal width is set to 80 in test3. * Diffpatch fails when the file name has a quote. * Getpgid is not supported on all systems. * The ";" command does not work after characters with a lower byte that is NUL. * Getting font name does not work on X11. * Some macros are in lower case, which can be confusing. * Part of fold patch accidentally included. * v:progpath is not reliably set. * Some macros are in lower case. * Some macros are in lower case. * Adding fold marker creates new comment. * Compiler warnings for comparing unsigned char with 256 always being true. (Manuel Ortega) * The mode test may hang in Test_mode(). (Michael Soyka) * Typo in MinGW test makefile. * Using :move messes up manual folds. * Potential crash if adding list or dict to dict fails. * Old fix for :move messing up folding no longer needed, now that we have a proper solution. * Can't build on HPUX. * Test 45 hangs on MS-Windows. * If an MS-Windows tests succeeds at first and then fails in a way it does not produce a test.out file it looks like the test succeeded. * Resetting 'compatible' in defaults.vim has unexpected side effects. (David Fishburn) * Can't find executable name on Solaris and FreeBSD. * Off-by-one error in using :move with folding. * There are still a few macros that should be all-caps. * Using g< after :for does not show the right output. (Marcin Szamotulski) * After aborting an Ex command g< does not work. (Marcin Szamotulski) * Compiler warnings on MS-Windows. * Not enough testing for help commands. * Exit callback test sometimes fails. * When a test fails and test.log is created, Test_edit_CTRL_I matches it instead of test1.in. * No test covering arg_all(). * The client-server feature is not tested. * Not enough testing for the client-server feature. * Missing change to main.c. * The client-server test may hang when failing. * Tests use assert_true(0) and assert_false(1) to report errors. * remote_peek() is not tested. * The remote_peek() test fails on MS-Windows. * Unnecessary if statement. * The setbufvar() function may mess up the window layout. (Kay Z.) * Illegal memory access when using :all. (Dominique Pelle) * Using :lhelpgrep with an argument that should fail does not produce an error if the previous :helpgrep worked. * Not all windows commands are tested. * Crash and endless loop when closing windows in a SessionLoadPost autocommand. * The autocmd test hangs on MS-Windows. * Running tests leaves an "xxx" file behind. * Clipboard and "* register is not tested. * Splitting a 'winfixwidth' window vertically makes it one column smaller. (Dominique Pelle) * The quotestar test fails when a required feature is missing. * A failing client-server request can make Vim hang. * Crash with cd command with very long argument. * Build failure with older compiler on MS-Windows. * The quotestar test uses a timer instead of a timeout, thus it cannot be rerun like a flaky test. * Insufficient testing for folding. * Arabic support is not fully tested. * Two autocmd tests are skipped on MS-Windows. * taglist() does not prioritize tags for a buffer. * Quotestar test is still a bit flaky. * On MS-Windows ":!start" does not work as expected. * Coverity complains about possible NULL pointer. * Endless loop in updating folds with 32 bit ints. * Looking up an Ex command is a bit slow. * Failed window split for :stag not handled. (Coverity CID 99204) * Can't build with ANSI C. * Client-server tests fail when $DISPLAY is not set. * Coveralls no longer shows per-file coverage. * No link to codecov.io results. * Typo in link to codecov.io results. * Menuage for skipping client-server tests is unclear. * Check for available characters takes too long. * Getting name of cleared highlight group is wrong. (Matt Wozniski) * Script for creating cmdidxs can be improved.- Disable term=xxx test, does not work with any vim version * vim-8.0-ttytype-test.patch- Update apparmor.vim (taken from AppArmor 2.11) * add support for the "kcm" and "qipcrtr" network keywords * update change_profile rule highlighting- Build default vim without X11 support, use update-alternatives to prefer gvim if installed for X11 support.- Updated to revision 425, fixes the following problems * Packadd test does not clean up symlink. * Packadd test uses wrong directory name. * The E11 error message in the command line window is not translated. * The "zero count" error doesn't have a number. (Hirohito Higashi) * Xfontset and guifontwide are not tested. * Illegal memory access after "vapo". (Dominique Pelle) * Restoring help snapshot accesses freed memory. (Dominique Pelle) * GUI test fails on some systems. * Illegal memory access when 'complete' ends in a backslash. * Can't access b:changedtick from a dict reference. * Functions test fails. * Flags of :substitute not sufficiently tested. * Invalid memory access in :recover command. * :recover test fails on MS-Windows. * Illegal memory access with vi' * Not checking return valud of dict_add(). (Coverity) * When using complete() and typing a character undo is saved after the character was inserted. (Shougo) * Double free when compiled with EXITFREE and setting 'ttytype'. * b:changedtick can be unlocked, even though it has no effect. * Unlet command leaks memory. (Nikolai Pavlov) * islocked('d.changedtick') does not work. * Vim relies on limits.h to be included indirectly, but on Solaris 9 it may not be. (Ben Fritz) * When using CTRL-X CTRL-U inside a comment, the use of the comment leader may not work. (Klement) * When building with a shadow directory on macOS lacks the +clipboard feature. * Redrawing errors with GTK 3. * Not enough test coverage for Perl. * No test for concatenating an empty string that results from out of bounds indexing. * The condition for when a typval needs to be cleared is too complicated. * If [RO] in the status line is translated to a longer string, it is trunctted to 4 bytes. * Test to check that setting termcap key fails sometimes. * Using uninitialized memory when 'isfname' is empty. * Leaking memory when setting 'ttytype'. * Crash when setting 'guicursor' to weird value. * Invalid memory access in C-indent code. * 'number' and 'relativenumber' are not properly tested. * Sometimes VimL is used, which is confusing. * GUI initialisation is not sufficiently tested. * Tests fail on MS-Windows. * Travis is too slow to keep up with patches. * ]s does not move cursor with two spell errors in one line. * Might free a dict item that wasn't allocated. * Build fails with tiny features. * If configure defines _LARGE_FILES some include files are included before it is defined. * Not all options are tested with a range of values. * The 'balloondelay', 'ballooneval' and 'balloonexpr' options are not defined without the +balloon_eval feature. Testing that an option value fails does not work for unsupported options. * Invalid memory access when setting wildchar empty. * Leaking memory when setting v:completed_item. * More options are not always defined. * Build fails without +folding. * Invalid memory access when using :sc in Ex mode. (Dominique Pelle) * The "+ register is not tested. * Size computations in spell file reading are not exactly right. * Possible overflow when reading corrupted undo file. CVE-2017-6349 bsc#1027057 * Another possible overflow when reading corrupted undo file. CVE-2017-6350 bsc#1027053 * CTRL-Z and mouse click use CTRL-O unnecessary. * With 'linebreak' set and 'breakat' includes ">" a double-wide character results in "<<" displayed. * Diff mode is not sufficiently tested. * Warning in tiny build for unused variable. (Tony Mechelynck) * Misplaced #ifdef. (Christ van Willigen) * Timer test failed for no apparent reason. * No tests for arabic. * Tiny build has a problem with generating the options test. * compiler warnings * filtering lines through "cat", without changing the line count, changes manual folds. * Test for arabic does not check what is displayed. * When the window scrolls horizontally when the popup menu is displayed part of it may not be cleared. (Neovim issue #6184) * Arabic support is verbose and not well tested. * GUI test fails with Athena and Motif. * When the same tag appears more than once, the order is unpredictable. (Charles Campbell) * Tabs are not aligned when scrolling horizontally and a Tab doesn't fit. (Axel Bender) * Testing the + register fails with Motif. * 'balloonexpr' only works synchronously. * Cannot build with the viminfo feature but without the eval feature. * Illegal memory access with "t". * Crash when using balloon_show() when not supported. (Hirohito Higashi) * Some tests have a one second delay. * Test fails with missing balloon feature. * :map completion does not have . (Dominique Pelle) * GUI tests may fail. * Not enough testing for quickfix. * v:progpath may become invalid after ":cd". * The arabic shaping code is verbose. * Filtering folds with marker method not tested. * Updating folds does not work properly when inserting a file and a few other situations. * set_progpath is defined but not always used * Newer gettext/iconv library has extra dll file. * We can't change the case in menu entries, it breaks translations. * Menu test fails on MS-Windows. * Menu test fails on MS-Windows using gvim. * Balloon eval is not tested. * Balloon test fails on MS-Windows. * Setting v:progpath is not quite right. * Test for the clipboard fails sometimes. * ASAN logs are disabled and don't cause a failure. * Test for v:progpath fails on MS-Windows. * When running :make the output may be in the system encoding, different from 'encoding'. * Diff mode is displayed wrong when adding a line at the end of a buffer. * Python test fails with Python 3.6. * The effect of adding "#" to 'cinoptions' is not always removed. * Compiler warnings on MS-Windows. (Ajit Thakkar) * Build errors when building without folding. - Drop test87-python36.patch, fixed upstream.- Add test87-python36.patch to update test results for Python 3.6- Updated to revision 324, fixes the following problems * When a json message arrives in pieces, the start is dropped and the decoding fails. * Not enough testing for GUI functionality. * getcmdtype(), getcmdpos() and getcmdline() are not tested. * ":help :[range]" does not work. (Tony Mechelynck) * ":help z?" does not work. (Pavol Juhas) * No test for setting 'guifont'. * Small mistake in 7x13 font name. * Insert mode completion does not respect "start" in 'backspace'. * Warning for unused variable with small build. * When using the tiny version trying to load the matchit plugin gives an error. On MS-Windows some default mappings fail. * Possible overflow with spell file where the tree length is corrupted. CVE-2017-5953 bsc#1024724 * When running the command line tests there is a one second wait. * Illegal memory access with "1;y".- Updated to revision 311, fixes the following problems * Double free on exit when using a closure. (James McCoy) * Ex command range with repeated search does not work. (Bruce DeVisser) * When the GUI window is resized Vim does not always take over the new size. (Luchr) * Cannot stop diffing hidden buffers. (Daniel Hahler) * No tests for ":set completion" and various errors of the :set command. * Cannot set terminal key codes with :let. * Bracketed paste does not work in Visual mode. * Assign test fails in the GUI. * Invalid memory access when option has duplicate flag. * mode() not sufficiently tested. * Asan detects a memory error when EXITFREE is defined. (Dominique Pelle) * When using a symbolic link, the package path will not be inserted at the right position in 'runtimepath'. (Dugan Chen, Norio Takagi) * Cannot use an empty key in json. * Not enough testing for GUI functionality. * Linebreak tests are old style.- Updated to revision 296, fixes the following problems * Jumping to a tag that is a static item in the current file fails. (Kazunobu Kuriyama) * The test for :profile is slow and does not work on MS-Windows. * On MS-Windows the system() test skips a few parts. * Some syntax arguments take effect even after "if 0". (Taylor Venable) * Warning for an unused parameter when the libcall feature is disabled. Warning for a function type cast when compiling with -pedantic. * Some syntax arguments are not tested. * When completing a group name for a highlight or syntax command cleared groups are included. * No test for invalid syntax group name. * Order of complication flags is sometimes wrong. * Compiler warns for uninitialized variable. (Tony Mechelynck) * After :undojoin some commands don't work properly, such as :redo. (Matthew Malcomson) * Test coverage for :retab insufficient. * Leaking file descriptor when system() cannot find the buffer. (Coverity) * Internally used commands for CTRL-Z and mouse click end up in history. (Matthew Malcomson) * When using :substitute with the "c" flag and 'cursorbind' is set the cursor is not updated in other windows. * Vim does not support bracketed paste, as implemented by xterm and other terminals. * Build fails if the multi-byte feature is disabled. * The buffer used to store a key name theoreticaly could be too small. (Coverity) * The Netbeans "specialKeys" command does not check if the argument fits in the buffer. (Coverity) * Leaking memory when syntax cluster id is unknown. (Coverity) * When a Cscope line contains CTRL-L a NULL pointer may be used. (Coverity) * When decoding JSON with a JS style object the JSON test may use a NULL pointer. (Coverity) * Build fails without the cscope feature. * No command line completion for :cexpr, :cgetexpr, :caddexpr, etc. * Ubsan reports errors for integer overflow. * Completion for :match does not show "none" and other missing highlight names. * Checking if PROTO is defined inside a function has no effect. * When a multi-byte character ends in a zero byte, putting blockwise text puts it before the character instead of after it. * Coverity gets confused by the flags passed to find_tags() and warnts for an uninitialized variable. * When 'fileformats' is changed in a BufReadPre auto command, it does not take effect in readfile(). (Gary Johnson) * When a block is visually selected and put is used on the end of the selection only one line is changed. * The test for patch 8.0.0224 misses the CR characters and passes even without the fix. (Christian Brabandt) * Crash when 'fileformat' is forced to "dos" and the first line in the file is empty and does not have a CR character. * When pasting test in an xterm on the command line it is surrounded by and . (Johannes Kaltenbach) * When freeing a buffer the local value of the 'formatprg' option is not cleared. * When using bracketed paste line breaks are not respected. * There are no tests for bracketed paste mode. * Pasting in Insert mode does not work when bracketed paste is used and 'esckeys' is off. * The paste test fails if the GUI is being used. * When several lines are visually selected and one of them is short, using put may cause a crash. (Axel Bender) * Memory leak detected when running tests for diff mode. * Gcc complains that a variable may be used uninitialized. Confusion between variable and label name. (John Marriott) * When setting wildoptions=tagfile the completion context is not set correctly. (desjardins) * When using bracketed paste autoindent causes indent to be increased. * The address sanitizer sometimes finds errors, but it needs to be run manually. * The clang build on CI fails with one configuration. * Vim defines a mch_memmove() function but it doesn't work, thus is always unused. * Completion of user defined functions is not covered by tests. * When making a character lower case with tolower() changes the byte cound, it is not made lower case. * When the user sets t_BE empty after startup to disable bracketed paste, this has no direct effect. * The generated zh_CN.cp936.po message file is not encoded properly. * Compiler warnings for int to pointer conversion. * Under some circumstances, one needs to type Ctrl-N or Ctrl-P twice to have a menu entry selected. (Lifepillar) * vim_strcat() cannot handle overlapping arguments. * When two submits happen quick after each other, the tests for the first one may error out. * When virtcol() gets a column that is not the first byte of a multi-byte character the result is unpredictable. (Christian Ludwig) * It is not so easy to write a script that works with both Python 2 and Python 3, even when the Python code works with both. * Characters below 256 that are not one byte are not always recognized as word characters. * When creating a session when winminheight is 2 or larger and loading that session gives an error. * When using an assert function one can either specify a message or get a message about what failed, not both. * When calling setpos() with a buffer argument it often is ignored. (Matthew Malcomson) * Tests fail because some changes were not included. * The keyword test file is not included in the archive. * The keyword test file is not included in the archive. * Tab commands do not handle count correctly. (Ken Hamada) * Build fails with tiny features. * Not enough test coverage for eval functions. * Farsi support is barely tested. * Farsi support is not tested enough. * Memory error reported by ubsan, probably for using the string returned by execute(). * May get ml_get error when :pydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * Compiler warning for using uninitialized variable. * A channel test sometimes fails on Mac. * May get ml_get error when :luado deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :perldo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :rubydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :tcldo deletes lines or switches to another buffer. (Nikolai Pavlov, closes #1421) * Crash on exit is not detected when running tests. * Dead code detected by Coverity when not using gnome. * When update_single_line() is called recursively, or another screen update happens while it is busy, errors may occur. * When checking for CTRL-C typed the GUI may detect a screen resize and redraw the screen, causing trouble. * Checking for FEAT_GUI_GNOME inside GTK 3 code is unnecessary. * The GUI test may trigger fontconfig and take a long time. * GUI test fails on MS-Windows. * With MSVC 2015 the dll name is vcruntime140.dll. * On MS-Windows setting an environment variable with multi-byte strings does not work well. * MS-Windows files are still using ARGSUSED while most other files have UNUSED. * When doing a Visual selection and using "I" to go to insert mode, CTRL-O needs to be used twice to go to Normal mode. (Coacher) * The return value of mode() does not indicate that completion is active in Replace and Insert mode. (Zhen-Huan (Kenny) Hu) * The Test_collapse_buffers() test failed once, looks like it is flaky. * Tests fail with tiny build on Unix. * When concealing is active and the screen is resized in the GUI it is not immediately redrawn. * Cannot access the arguments of the current function in debug mode. (Luc Hermitte) * Errors reported while running tests. * No test for "ga" and :ascii. * If a wide character doesn't fit at the end of the screen line, and the line doesn't fit on the screen, then the cursor position may be wrong. (anliting) * Visual block insertion does not insert in all lines. * The stat test is a bit slow. * Some tests have a one or three second wait. * Argument list is not stored correctly in a session file. (lgpasquale) * test_viml hangs. * Bracketed paste can only append, not insert.- Improve summary bsc#1021040- Add missing %changelog to spec.skeleton- Updated to revision 194, fixes the following problems * When compiling with EBCDIC defined the build fails. (Yaroslav Kuzmin) * For completion "locale -a" is executed on MS-Windows, even though it most likely won't work. * Setting language in gvim on MS-Windows does not work when libintl.dll is dynamically linked with msvcrt.dll. * Using :change in between :function and :endfunction fails. * When opening a buffer on a directory and inside a try/catch then the BufEnter event is not triggered. * test_command_count may fail when a previous test interferes, seen on MS-Windows. * 'formatprg' is a global option but the value may depend on the type of buffer. (Sung Pae) * Error E937 is used both for duplicate key in JSON and for trying to delete a buffer that is in use. * When 'cursorbind' and 'cursorcolumn' are both on, the column highlignt in non-current windows is wrong. * When 'cursorbind' and 'cursorline' are set, but 'cursorcolumn' is not, then the cursor line highlighting is not updated. (Hirohito Higashi) * Ubsan warns for using a pointer that is not aligned. * When in Ex mode and an error is caught by try-catch, Vim still exits with a non-zero exit code. * The system() test fails on MS-Windows. * The error message from assert_notequal() is confusing. * Building with a new Ruby version fails. * Using NOT_VALID for redraw_later() to update the cursor line/column highlighting is not efficient. * There are no tests for the :profile command. * Detecting duplicate tags uses a slow linear search. * Some systems do not have ruby_sysinit(), causing the build to fail. * Build fails with tiny features. * Accidentally removed #ifdef. * Profile tests fails if total and self time are equal.- Updated to revision 172, fixes the following problems * When a C preprocessor statement has two line continuations the following line does not have the right indent. (Ken Takata) * ":earlier" and ":later" do not work after startup or reading the undo file. * When the pattern of :filter does not have a separator then completion of the command fails. * To pass buffer content to system() and systemlist() one has to first create a string or list. * Running the channel test creates channellog. * system() test fails on MS-Windows. * system() test fails on OS/X. * When sorting zero elements a NULL pointer is passed to qsort(), which ubsan warns for. * Several float functions are not covered by tests. * No command line completion for ":syntax spell" and ":syntax sync". * On MS-Windows some float functions return a different value when passed unusual values. strtod() doesn't work for "inf" and "nan". * Using a NULL pointer when using feedkeys() to trigger drawing a tabline. * EMSG() is sometimes used for internal errors. * Build fails when using small features. * Build error on Fedora 23 with small features and gnome2. * Ruby 2.4 no longer supports rb_cFixnum. * Outdated and misplaced comments. * Ubsan warns for integer overflow. * JSON with a duplicate key gives an internal error. (Lcd) * str2nr() and str2float() do not always work with negative values. * Still some float functionality is not covered by tests. * For complicated string json_decode() may run out of stack space. * Channel test fails for using freed memory. * JS style JSON does not support single quotes. * The command selected in the command line window is not executed. (Andrey Starodubtsev)- Updated to revision 147, fixes the following problems * Not enough test coverage for syntax commands. * Test fails because of using :finish. * "2;'(" causes ml_get errors in an empty buffer. * Null pointer access reported by UBsan. * An address relative to the current line, ":.,+3y", does not work properly on a closed fold. * When using indent folding and changing indent the wrong fold is opened. * When 'maxfuncdepth' is set above 200 the nesting is limited to 200. * Small build fails. * Warning for unused argument. * Pasting inserted text in Visual mode does not work properly. * Nested function test fails on AppVeyor. * Normal colors are wrong with 'termguicolors'. * Line number of current buffer in getbufinfo() is wrong. * When using MSVC the GvimExt directory is cleaned twice. * Running tests on MS-Windows is a little bit noisy. * When using 'termguicolors' on MS-Windows the RGB definition causes the colors to be wrong. * searchpair() does not work when 'magic' is off.- Updated to revision 130, fixes the following problems * Not enough testing for entering Ex commands. * Display problem with 'foldcolumn' and a wide character. (esiegerman) * Cancelling completion still inserts text when formatting is done for 'textwidth'. (lacygoill) * Display test fails on MS-Windows. * Parallel make still doesn't work. (Lewis Muir) * Configure uses "ushort" while the Vim code doesn't.- Updated to revision 124, fixes the following problems * May not process channel readahead. (skywind) * Value of 'thesaurus' option not checked properly. * When using ch_read() with zero timeout, can't tell the difference between reading an empty line and nothing available. * Cannot use a semicolon in 'backupext'. (Jeff) * When reading channel output in a timer, messages may go missing. (Skywind) * The channel "drop" option is not tested. * Still checking if memcmp() exists while every system should have it now. * Drop command doesn't use existing window. * The :history command is not tested. * Tests 92 and 93 are old style. * When reading English help and using CTRl-] the language from 'helplang' is used. * Parallel make fails. (J. Lewis Muir) * No test for using CTRL-R on the command line. * Setting 'cursorline' changes the curswant column. (Daniel Hahler) * Internal error for assert_inrange(1, 1).- Updated to revision 101, fixes the following problems * When the input or output is not a tty Vim appears to hang. * When a channel callback consumes a lot of time Vim becomes unresponsive. (skywind) * Can't build on MS-Windows. * Popup menu always appears above the cursor when it is in the lower half of the screen. (Matt Gardner) * Options that are a file name may contain non-filename characters. * Some options are not strictly checked. * (after 8.0.0101) cannot set 'dictionary' to a path- Updated to revision 95, fixes the following problems * Problems with GTK 3.22.2 fixed in 3.22.4.- Export "TERM=linux" before running the test suite: vim does quite an extensive test relying on a full fledged terminal inside OBS, stdio is redirected to a serial console (where the build log is being recorded/extracted. Systemd set non-local tty by default to vt220 in upcoming versions (which the vi test suite fails to run on; this should be considered a vim bug).- Updated to revision 92, fixes the following problems * Using NUL instead of NULL. * Crash when using the preview window from an unnamed buffer. (lifepillar) * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * When a match ends in part of concealed text highlighting, it might mess up concealing by resetting prev_syntax_id. * An exiting job is detected with a large latency. * New code for job_stop() breaks channel test on AppVeyor. * Conceal test passes even without the bug fix. * No test for what 8.0.0047 fixes. * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * Minor comment and style deficiencies. * When setting 'filetype' there is no check for a valid name. * Tests fail without the 'keymap' features. * Positioning of the popup menu is not good. * Vim does not build on VMS systems. * When using an Ex command for 'keywordprg' it is escaped as with a shell command. (Romain Lafourcade) * Compiler warning for unused variable. * No digraph for HORIZONTAL ELLIPSIS. * Compiler warning for comparing with unsigned. (Zoltan Arpadffy) * Normal test fails on MS-Windows. * Compiler warning for unused function in tiny build. (Tony Mechelynck) * when calling an operator function when 'linebreak' is set, it is internally reset before calling the operator function. * VMS has a problem with infinity. * Checking did_throw after executing autocommands is wrong. (Daniel Hahler) * Compiler warning for self-comparison. * Tests referred in Makefile that no longer exist. * Exit value from a shell command is wrong. (Hexchain Tong) * MS-Windows: Crash with long font name. (Henry Hu) * More comparisons between firstwin and lastwin. * Cannot make Vim fail on an internal error. * Using number for exception type lacks type checking. * Channel log has double parens ()(). * The GUI code is not tested by Travis. * Accessing freed memory in quickfix. * Accessing freed memory in quickfix. (Domenique Pelle) * The OS X build fails on Travis. * Inconsistent function names. * Extension for configure should be ".ac". * Using freed memory with win_getid(). (Domenique Pelle) * Using freed memory when adding to a quickfix list. (Domenique Pelle) * Using freed memory with recursive function call. (Dominique Pelle) * Cannot add a comment after ":hide". (Norio Takagi) * When the channel callback gets job info the job may already have been deleted. (lifepillar) * When a test fails in Setup or Teardown the problem is not reported. * Various problems with GTK 3.22.2. * Cursor moved after last character when using 'breakindent'. * Test_help_complete sometimes fails in MS-Windows console. * C indenting does not support nested namespaces that C++ 17 has. - Drop bsc-1008800.patch, fixed upstream.- Add bsc-1008800.patch to fix gvim rendering with recent gtk+ update. Fixes bsc#1008800. Patch by Jan Alexander Steffens.- Updated to revision 45, fixes the following problems * Cannot use overlapping positions with matchaddpos(). * No completion for ":messages". * Order of matches for 'omnifunc' is messed up. (Danny Su) * Detecting that a job has finished may take a while. * Get E924 when switching tabs. * OPEN_CHR_FILES not defined for FreeBSD using Debian userland files. * When Vim 8 reads an old viminfo and exits, the next time marks are not read from viminfo. (Ned Batchelder) * Whole line highlighting with matchaddpos() does not work. * When using Insert mode completion but not actually inserting anything an undo item is still created. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" change is not saved for undo. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" with CTRL-N the change is not saved for undo. (Tommy Allen) * In diff mode the cursor may end up below the last line, resulting in an ml_get error. * Calling job_stop() right after job_start() does not work.- Updated to revision 32, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy) * A string argument for function() that is not a function name results in an error message with NULL. (Christian Brabandt) * Netbeans test fails with Python 3. (Jonathonf) * ":lb" is interpreted as ":lbottom" while the documentation says it means ":lbuffer". * Vim 7.4 is still mentioned in a few places. * Popup complete test is disabled. * Unnecessary workaround for AppVeyor. * Crash when editing file that starts with crypt yeader. (igor2x) * On OSX Test_pipe_through_sort_all() sometimes fails. * Typos in comments. * Missing comma in list. * Crypt tests are old style. * Can't tell which part of a channel has "buffered" status. * Build fails. * Cannot get the number of the current quickfix or location list. * When using ":sleep" channel input is not handled. * Test_command_count is old style. * The regexp engines are not reentrant. * In the GUI when redrawing the cursor it may be on the second half of a double byte character. * If a channel in NL mode is missing the NL at the end the remaining characters are dropped. * "gd" and "gD" may find a match in a comment or string. * When the netbeans channel closes, "DETACH" is put in the output part. (Ozaki Kiichi) * Inconsistent use of spaces vs tabs in gd test. * Error format with %W, %C and %Z does not work. (Gerd Wachsmuth) * A channel is closed when reading on stderr or stdout fails, but there may still be something to read on another part. * Superfluous semicolons. * Code for MS-Windows is complicated because of the exceptions for old systems. * Mouse mode is not automatically detected for tmux. * After ":bwipeout" 'fileformat' is not set to the right default.- Updated to revision 3, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy)- Updated to revision 2, fixes the following problems * Intro screen still mentions version7. (Paul) * The netrw plugin does not work.- Update to version 8.0 * Crash on exit when EXITFREE is defined. (Dominique Pelle) * Valgrind reports using uninitialzed memory. (Dominique Pelle) * Test 86 and 87 fail with some version of Python. * Netbeans test fails when run from unpacked MS-Windows sources. * Netbeans test fails in shadow directory. * Not enough test coverage for Normal mode commands. * The example that explains nested backreferences does not work properly with the new regexp engine. (Harm te Hennepe) * Regexp fails to match when using "\>\)\?". (Ramel) * Reading past end of line when using previous substitute pattern. (Dominique Pelle) * Attempt to read history entry while not initialized. * Compiler warnings with Solaris Studio when using GTK3. * Memory leak in timer_start(). * Invalid memory access when formatting. (Dominique Pelle) * Checking for last_timer_id to overflow is not reliable. (Ozaki Kiichi) * Illegal memory access with ":1@". (Dominique Pelle) * Superfluous function prototypes. * Sort test sometimes fails. * Needless line break. Confusing directory name. * MS-Windows gvim.exe does not have DirectX support. * Test runner misses a comma.- Updated to revision 2347, fixes the following problems * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails. * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind. * taglist() is slow. (Luc Hermitte) * Running normal mode tests leave a couple of files behind. (Yegappan Lakshmanan) * taglist() is still slow. (Luc Hermitte) * Can't build with small features. (John Marriott) * Tab page test fails when run as fake root. * MS-Windows: Building with Ruby uses old version. * Tiny things. Test doesn't clean up properly. * Typo in MS-Windows build script. * Too many old style tests. * The "Reading from channel output..." message can be unwanted. Appending to a buffer leaves an empty first line behind. * For MinGW RUBY_API_VER_LONG isn't set correctly. Many default version numbers are outdated. * Autocommand test fails when run directly, passes when run as part of test_alot.- Updated to revision 2334, fixes the following problems * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind.- Updated to revision 2295, fixes the following problems * The field names used by getbufinfo(), gettabinfo() and getwininfo() are not consistent. * Tab page tests are old style. * Test files have inconsistant modelines. * Startup test fails on Solaris. * There is no equivalent of 'smartcase' for a tag search. * ":oldfiles" output is a very long list. * The default ttimeoutlen is very long. * Crash when using funcref() with invalid name. (Dominique Pelle) * Can't build with +eval but without +quickfix. (John Marriott) * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails.- Updated to revision 2225, fixes the following problems * When using matchaddpos() a character after the end of the line can be highlighted. * Can't build with +timers when +digraph is not included. * Recursive call to substitute gets stuck in sandbox. * printf() gives an error when the argument for %s is not a string. * printf() does not support binary format. * Sourcing a script where a character has 0x80 as a second byte does not work. * Buffer overflow when using latin1 character with feedkeys(). * Compiler warnings with older compiler and 64 bit numbers. * Crash when placing a sign in a deleted buffer.- Updated to revision 2216, fixes the following problems * The qf_init_ext() function is too big. * Compiler warning for initializing a struct. * There is still code and help for unsupported systems. * There is no way to get a list of the error lists. * When using ":vimgrep" may end up with duplicate buffers. * No proper testing of trunc_string(). * Coverage report is messed up by the unittests. * Can't run scripttests in the top directory. * Wrong part of #ifdef removed. * eval.c is too big. * Build fails. * eval.c is too big. * eval.c is too big. * Non-Unix builds fail. * Wrong file name. * qf_init_ext() is too big. * Using dummy variable to compute struct member offset. * eval.c is still too big. * Coverity warns for possible buffer overflow. * Compiler warns for uninitialzed variable. (John Marriott) * getcompletion() not well tested. * Compiler warning for char/char_u conversion. * Not all arguments of trunc_string() are tested. Memory access error when running the message tests. * spell.c is too big. * Missing change to include file. * The return value of type() is difficult to use. * substitute() does not support a Funcref argument. * rgb.txt is read for every color name. * One more place using a dummy variable. * No autocommand event to initialize a window or tab page. * Syntax error when dict has '>' key. * Cannot update 'tabline' when a tab was closed. * Running checks in po diretory fails. * Netbeans test fails on non-Unix systems. * When using PERROR() on some systems assert_fails() does not see the error. * Line numbers in the error list are not always adjusted. * Not much test coverage for digraphs. * Coverity complains about not restoring a value. * New digraph test makes testing hang. * Digraph tests fails on some systems. * Using the system default encoding makes tests unpredictable. * Digraph code test coverage is still low. * Keymap test fails with normal features. * Color handling of X11 GUIs is too complicated. * Using submatch() in a lambda passed to substitute() is verbose. * Coverity reports a resource leak when out of memory. * GTK 3 build fails with older GTK version. * Netbeans test fails once in a while. Leaving log file behind. * The color allocation in X11 is overly complicated. * Man test fails when run with the GUI. * Lambda functions show up with completion. * Warning from 64 bit compiler. * Text object tests are old style. * When a keymap is active only "(lang)" is displayed. * "cgn" and "dgn" do not work correctly with a single character match and the replacement includes the searched pattern. * Looping over windows, buffers and tab pages is inconsistant. * Tiny build with GUI fails. * Can't have "augroup END" right after ":au!". * Code duplication when unreferencing a function. * Configure reports default features to be "normal" while it is "huge". * Clang warns about missing field in initializer. * Misplaced equal sign. * Netbeans test is flaky. * Setting 'display' to "lastline" is a drastic change, while omitting it results in lots of "@" lines. * When there is an CmdUndefined autocmd then the error for a missing command is E464 instead of E492. (Manuel Ortega) * Defaults are very conservative. * getcompletion(.., 'dir') returns a match with trailing "*" when there are no matches. * Test for undo is flaky. * Tiny build fails. * Loading defaults.vim with -C argument. * The default vimrc for Windows is very conservative. * Deleting an augroup that still has autocmds does not give a warning. The next defined augroup takes its place. * Mac: can't build with tiny features. * Closures are not supported. * User defined functions can't be a closure. * No easy way to check if lambda and closure are supported. * Mac: don't get +clipboard in huge build. * No new style test for diff mode. * diffmode test leaves files behind, breaking another test. * Compiler warning for loss of data. * No tests for :diffget and :diffput * The short form of ":noswapfile" is ":noswap" instead of ":nos". * Memory leak when saving for undo fails. * Memory leak when using timer_start(). (Dominique Pelle) * Pending timers cause false memory leak reports. * More memory leaks when using partial, e.g. for "exit-cb". * test_partial has memory leaks reported. * Can't build with tiny features. * No error for using function() badly. * Various tiny issues. * Closure function fails. * Using function() with a name will find another function when it is redefined. * Test 86 and 87 fail. * :delfunction causes illegal memory access. * Tiny build fails. * Coverity reports bogus NULL check. * Leaking memory when redefining a function. * A funccal is garbage collected while it can still be used. * On MS-Windows quickix does not handle a line with 1023 bytes ending in CR-LF properly. * Win32: Using CreateThread/ExitThread is not safe. * Not enough testing for popup menu. CTRL-E does not always work properly. * test_alot fails. * Not much testing for cscope. * If a test leaves a window open a following test may fail. * Warning with MinGW 64. (John Marriott) * Quickfix test fails on MS-Windows. * No proper translation of messages with a count. * GUI test isn't testing much. * Test_communicate() fails sometimes. * Quotes make GUI test fail on MS-Windows. * Compiler warning. * Test_job_start_fails() is expected to report memory leaks, making it hard to see other leaks in test_partial. * Result of getcompletion('', 'cscope') depends on previous completion. * Insufficient testing for cscope. * setmatches() mixes up values. (Nikolai Pavlov) * Expression test fails without conceal feature. * Result of getcompletion('', 'sign') depends on previous completion. * match() and related functions tested with old style test. * It is not possible to use plugins in an "after" directory to tune the behavior of a package. * Startup test fails on MS-Windows. * Small build can't run startup test. * Small build can't run tests. * Not running the startup test on MS-Windows. * Startup test gets stuck on MS-Windows. * Cannot get information about timers. * MS-Windows build fails. * No test for "vim --help". * Can't test help on MS-Windows. * Adding duplicate flags to 'whichwrap' leaves commas behind. * Insufficient testing of cscope. * #ifdefs in main() are complicated. * No testing for -C and -N command line flags, file arguments, startuptime. * No test for reading from stdin. * Reading from stdin test fails on MS-Windows. * There is no easy way to stop all timers. There is no way to temporary pause a timer. * Compiler warning for unused variable. * Color Grey40 used in startup but not in the short list. * Sign tests are old style. * Tests that use RunVim() do not actually perform the test. * Test glob2regpat does not test much. * Timers test is flaky. * glob2regpat test fails on Windows. * Completion does not work properly with some plugins. * Cannot detect encoding in a fifo. * When startup test fails it's not easy to find out why. GUI test fails with Gnome. * No automatic prototype for vim_main2(). * Generating prototypes with Cygwin doesn't work well. * With Gnome when the GUI can't start test_startup hangs. * Sign tests don't cover enough. * MS-Windows: The vimrun program does not support Unicode. * glob2regpat test doesn't test everything on MS-Windows. * All functions are freed on exit, which may hide leaks. * Test alot sometimes fails under valgrind. (Dominique Pelle) * In the GUI the cursor is hidden when redrawing any window, causing flicker. * Cannot get all information about a quickfix list. * The sign column disappears when the last sign is deleted. * Build fails with small features. * Test fails with normal features. * It is not easy to get information about buffers, windows and tabpages. * 'wildignore' always applies to getcompletion(). * Warning for unused function. * The +xpm feature is not sorted properly in :version output. * Test for mappings is old style. * Cannot map . (Stephen Riehm) * On OSX configure mixes up a Python framework and the Unix layout. * Mouse support is not automatically enabled with simple term. * Mark " is not set when closing a window in another tab. (Guraga) * Cannot highlight the "~" lines at the end of a window differently. * A font that uses ligatures messes up the screen display. * It's not easy to find out if a window is a quickfix or location list window. * Test fails without the +sign feature.- Updated to revision 2045, fixes the following problems * Looking up a buffer by number is slow if there are many. * Netbeans file authentication not tested. * GTK: display updating is not done properly and can be slow. * setbufvar() causes a screen redraw. * filter() and map() either require a string or defining a function. * Memory leak when using a function callback.- Updated to revision 2033, fixes the following problems * Memory access error when reading viminfo. (Dominique Pelle) * "gd" hangs in some situations. (Eric Biggers) * Not all quickfix tests are also done with the location lists. * Background is not drawn properly when 'termguicolors' is set. * Coverity warns for unreachable code. * Win32: Cannot compile with XPM feature using VC2015 * The Man plugin doesn't work that well. * File list does not include new XPM libraries. * Viminfo continuation line with wrong length isn't skipped. (Marius Gedminas) * Using Ctrl-A with double-byte encoding may result in garbled text. * Minor problems with the quickfix code. * Quickfix long lines test not executed for buffer. * Ruby test is old style. * Cscope interface does not support finding assignments. * Not all parts of the quickfix code are tested. * No test for what 7.4.1948 fixes. * Using 32-bit Perl with 64-bit time_t causes memory corruption. (Christian Brabandt) * When using CTRL-W f and pressing "q" at the ATTENTION dialog the newly opened window is not closed. * Perl interface has obsolete workaround. * Perl interface preprocessor statements not nicely indented. * Crash when running test_channel.vim on Windows. * Unicode standard 9 was released. * When 'insertmode' is reset while doing completion the popup menu remains even though Vim is in Normal mode. * Two test files for increment/decrement. * Running Win32 Vim in mintty does not work. * The quickfix init function is too big. * When using a job in raw mode to append to a buffer garbage characters are added. * Coverity reports a resource leak. * Falling back from NFA to old regexp engine does not work properly. (fritzophrenic) * Invalid memory access with "\. * When the netbeans channel is closed consuming the buffer may cause a crash. * Using ":insert" in an empty buffer sets the jump mark. (Ingo Karkat) * It is not easy to see unrecognized error lines below the current error position. * On Solaris select() does not work as expected when there is typeahead. * GUI has a problem with some termcodes. * On MS-Windows large files (> 2Gbyte) cause problems. * Number variables are not 64 bits while they could be. * With 64 bit changes don't need three calls to sprintf(). * Large file test does not delete its output. * Getting value of binary option is wrong. (Kent Sibilev) * 'errorformat' is parsed for every call to ":caddexpr". Can't add to two location lists asynchronously. * No testing for Farsi code. * Viminfo file contains duplicate change marks. * farsi.c and arabic.c are included in a strange way. * Not all quickfix features are tested. * Missing changes in VMS build file. * Compiler warns for loss of data. * When copying unrecognized lines for viminfo, end up with useless continuation lines. * When updating viminfo with file marks there is no time order. * filter() and map() only accept a string argument. * Cscope items are not sorted. * glob() does not add a symbolic link when there are no wildcards. * Values for true and false can be confusing. * Not all TRUE and FALSE arguments are tested. * True-false test fails. * GUI: cursor drawn in wrong place if a timer callback causes a screen update. (David Samvelyan) * Capturing the output of a command takes a few commands. * Cannot easily scroll the quickfix window. * When writing buffer lines to a job there is no NL to NUL conversion. * evalcmd() doesn't work recursively. * Evalcmd test fails. * Tiny build fails. (Tony Mechelynck) * Crash when passing number to filter() or map(). * Still cursor flickering when a callback updates the screen. (David Samvelyan) * GUI: cursor displayed in the wrong position. * After using evalcmd() message output is in the wrong position. (Christian Brabandt) * Crash when using tabnext in BufUnload autocmd. (Norio Takagi) * Running the tests leaves a viminfo file behind. * evalcmd() has a confusing name. * Messages test fails. * There is a :cbottom command but no :lbottom command. * It is not easy to get a list of command arguments. * Test for getcompletion() does not pass on all systems. * Using "noinsert" in 'completeopt' breaks redo. * Using "noinsert" in 'completeopt' does not insert match. * When a file gets a name when writing it 'acd' is not effective. (Dan Church) * Warning from MinGW about _WIN32_WINNT redefined. (John Marriott) * When there are many errors adding them to the quickfix list takes a long time. * buf_valid() can be slow when there are many buffers. * When ignoring case utf_fold() may consume a lot of time. * Can't build without +autocmd feature. * Still too many buf_valid() calls. * Warnings from 64 bit compiler. * buflist_findname_stat() may find a dummy buffer. * More buf_valid() calls can be optimized. * The cursor blinking stops or is irregular when receiving date over a channel and writing it in a buffer, and when updating the status. * Reference counting for callbacks isn't right. * Can't build with +eval but without +menu. * cppcheck warns for using index before limits check. * printf() does not work with 64 bit numbers. * ARCH must be set properly when using MinGW. * The list_lbr_utf8 test fails if ~/.vim/syntax/c.vim sets 'textwidth' to a non-zero value. * Build fails with 64 bit MinGW. (Axel Bender) * 'cscopequickfix' option does not accept new value "a".- Updated to revision 1938, fixes the following problems * Updating marks in a quickfix list is very slow when the list is long. * When waiting for a character is interrupted by receiving channel data and the first character of a mapping was typed, the mapping times out. * When receiving channel data 'updatetime' is not respected. * Wrong computation of remaining wait time in RealWaitForChar() * When umask is set to 0177 Vim can't create temp files. * GUI: When channel data is received the cursor blinking is interrupted. * Channel reading very long lines is slow. * balloon eval only gets the window number, not the ID. * Cannot easily get the window ID for a buffer. * Cannot get the window ID for a mouse click. * Cannot use a window ID where a window number is expected. * Invoking mark_adjust() when adding a new line below the last line is pointless. * Various typos, long lines and style mistakes. * User commands don't support modifiers. * GTK 3: cursor blinking doesn't work well. * Using CTRL-] in the help on "{address}." doesn't work. * Win32: the "Disabled" menu items would appear enabled. * No test for collapsing buffers for a channel. Some text is lost. * When writing viminfo merging current history with history in viminfo may drop recent history entries. * Some compilers can't handle a double semicolon. * Collapsing channel buffers and searching for NL does not work properly. * Warnings from 64 bit compiler. * Netbeans uses uninitialzed pointer and freed memory. * Doubled semicolons. * Tests using external command to delete directory. * Recent history lines may be lost when exiting Vim. * No test for using setqflist() on an older quickfix list. * When ":doautocmd" is used modelines are used even when no autocommands were executed. * Executing autocommands while using the signal stack has a high chance of crashing Vim. * The effect of the PopupMenu autocommand isn't directly visible. * No proper test for what 7.4.1906 fixes. * History lines read from viminfo in different encoding than when writing are not converted. * Not enough testing for parsing viminfo lines. * Register contents is not merged when writing viminfo. * Missing test changes. * vim_time() not included when needed. * Ruby 2.4.0 unifies Fixnum and Bignum into Integer. * Command line editing is not tested much. * Missing "void" for functions without argument. * Viminfo does not merge file marks properly. * Possible crash with many history items. * Compiler warning for signed/unsigned. * Overwriting pointer argument. * Inconsistent indenting and weird name. * Can't build without +spell but with +quickfix. * Using both old and new style file mark lines from viminfo. * When writing viminfo the jumplist is not merged with the one in the viminfo file. * Compiler warning about uninitialzed variable. * New style tests not executed with MinGW compiler. * When using the GUI search/replace a second match right after the replacement is skipped. * Off-by-one error in bounds check. * No test for directory stack in quickfix. * When writing viminfo numbered marks were duplicated. - Refresh vim-7.3-filetype_spec.patch- Link to perl directly instead of dlopen'ing it.- vim must require %{?libperl_requires}, if perl is not updated with vim in lockstep, the following error occurs: vim: error while loading shared libraries: libperl.so and the program stops working. (boo#982869)- Updated to revision 1883, fixes the following problems * Python: encoding error with Python 2. * Memory leaks in test49. * Invalid memory access when exiting with EXITFREE defined. * Memory leak in test_matchstrpos. * Setting really_exiting causes memory leaks to be reported. * Appending to the quickfix list while the quickfix window is open is very slow. * When a callback adds a timer the GUI doesn't use it until later. * Comparing functions and partials doesn't work well. * Typing "k" at the hit-enter prompt has no effect. * Whether a job has exited isn't detected until a character is typed. After calling exit_cb the cursor is in the wrong place. * Channel test is flaky. * Appending to a long quickfix list is slow. * Check for line break at end of line wrong. * Cppcheck found 2 incorrect printf formats.- Updated to revision 1862, fixes the following problems * Using a partial for timer_start() may cause a crash. * Compiler warnings with 64 bit compiler. * string() with repeated argument does not give a result usable by eval().- Updated to revision 1859, fixes the following problems * Tests involving Python are flaky. * Ubsan detects a multiplication overflow. * Getting an item from a NULL dict crashes. * Can't build with Strawberry Perl 5.24 (obsoletes perl-5.24.patch) * Still trying to read from channel that is going to be closed. * GUI freezes when using a job. * test_syn_attr fails when using the GUI. * Unix: Cannot run all tests with the GUI. * Crash when job and channel are in the same dict while using partials. * When setting 'termguicolors' the Ignore highlighting doesn't work. * Valgrind reports memory leak for job that is not freed. * When a channel appends to a buffer that is 'nomodifiable' there is an error but appending is done anyway. * When a channel writes to a buffer it doesn't find a buffer by the short name but re-uses it anyway. * Cannot use a function reference for "exit_cb".- Update apparmor.vim (taken from AppArmor 2.10.1) * add support for the "unspec" network keyword- Updated to revision 1842, fixes the following problems * non-antialiased misnamed. * When timer_stop() is called with a string there is no proper error message. * Memory leak in debug commands. * Cannot use an Ex command for 'keywordprg'. * Possible crash when conceal is active. * When splitting and closing a window the status height changes. * When using a partial on a dictionary it always gets bound to that dictionary. * The BufUnload event is triggered twice, when :bunload is used with `bufhidden` set to `unload` or `delete`. * Functions specifically for testing do not sort together. * Cannot get the items stored in a partial. * When using packages an "after" directory cannot be used. * The code to reallocate the buffer used for quickfix is repeated. * get() works for Partial but not for Funcref.- Fix build with perl 5.24 (perl-5.24.patch)- Updated to revision 1829, fixes the following problems * No error when invoking a callback when it's not safe. * May try to access buffer that's already freed. * No message on channel log when buffer was freed.- Updated to revision 1826, fixes the following problems * The screen is not updated if a callback is invoked when closing a channel. * Help completion adds @en to all matches except the first one. * Compiler warnings when sprintf() is a macro. * Removing language from help tags too often. * Redirecting stdout of a channel to "null" doesn't work. * When a job is no longer referenced and does not have an exit callback the process may hang around in defunc state. * When job writes to buffer nothing is written. * Callbacks are invoked when it's not safe.- Updated to revision 1816, fixes the following problems * 'guicolors' is a confusing option name. * Quickfix doesn't handle long lines well, they are split. * GTK3 doesn't handle menu separaters properly. * Can't use Vim as MANPAGER. * Running tests in shadow dir fails. * 'termguicolors' option missing from the options window. * Test_out_close_cb sometimes fails. * Using wrong feature name to check for 'termguicolors'. * Using wrong short option name for 'termguicolors'. * Sending DETACH after a channel was closed isn't useful. * Netbeans channel gets garbage collected. * Memory access error when running test_quickfix. * A channel may be garbage collected while it's still being used by a job. * Looping over a null list throws an error. - Refresh vim-7.4-filetype_mine.patch- Updated to revision 1796, fixes the following problems * Cannot use ch_read() in the close callback. * Leading white space in a job command matters. * Channel could be garbage collected too early. * Color name decoding is implemented several times. * Some character classes may differ between systems.- Updated to revision 1786, fixes the following problems * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default. * Using negative index in strcharpart(). * Warnings reported by cppcheck. * synIDattr() does not respect 'guicolors'. * strcharpart() does not work properly with some multi-byte characters. * The old regexp engine doesn't handle character classes correctly. * Compiled-in colors do not match rgb.txt.- Updated to revision 1778, fixes the following problems * When using complete() it may set 'modified' even though nothing was inserted. * When using feedkeys() in a timer the inserted characters are not used right away. * Undo options are not together in the options window. * Arguments of setqflist() are not checked properly. * No "closed", "errors" and "encoding" attribute on Python output. * Cannot use true color in the terminal. * Newly added features can escape the sandbox. * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default.- Updated to revision 1754, fixes the following problems * When a buffer gets updated while in command line mode, the screen may be messed up. * Crash when 'tagstack' is off. (Dominique Pelle) * When adding to the quickfix list the current position is reset. * "noinsert" in 'completeopt' is sometimes ignored * syntax not set when using ":buf" and 'filetype' set manually- Updated to revision 1749, fixes the following problems * Cannot detect a crash in tests when caused by garbagecollect(). * The help for functions require a space after the "(". * The Perl interface cannot use 'print' operator for writing directly in standard IO. * It is not easy to get a character out of a string. * Python: turns partial into simple funcref. * Folds may close when using autocomplete. * Test fails when not using utf-8. * It is not possible to only see part of the message history. It is not possible to clear messages. * Count for ":messages" depends on number of lines. * syn-cchar defined with matchadd() does not appear if there are no other syntax definitions which matches buffer text. * Not testing utf-8 characters. * strgetchar() does not work correctly. * Clang warns for uninitialzed variable. (Michael Jarvis) * Python: Converting a sequence may leak memory. * Memory leak in Perl. * Coverity: missing check for NULL pointer. * "gD" does not find match in first column of first line. * When using GTK 3.20 there are a few warnings.- Updated to revision 1726, fixes the following problems * Crash when calling garbagecollect() after starting a job. * When using try/catch in 'tabline' it is still considered an error and the tabline will be disabled. * Tabline test fails in GUI. * Compiler errors for non-ANSI compilers. * ANSI compiler complains about string length.- Updated to revision 1721, fixes the following problems * Leaking memory when opening a channel fails. * Coverity: not using return value of set_ref_in_item(). * Leaking memory when there is a cycle involving a job and a partial. * Tests fail without the job feature.- Updated to revision 1716, fixes the following problems * When using try/catch in 'statusline' it is still considered an error and the status line will be disabled. * For plugins in packages, plugin authors need to take care of all dependencies. * GTK GUI doesn't work on Wayland. * Non-GUI specific settings in the gvimrc_example file. * Double free when a partial is in a cycle with a list or dict. * 'autochdir' doesn't work for the first file.- Updated to revision 1710, fixes the following problems * feedkeys('i', 'x') gets stuck, waits for a character to be typed. * Building the Perl interface gives compiler warnings. * ":syn reset" clears the effect ":syn iskeyword". (James McCoy) * When using :stopinsert in a silent mapping the "INSERT" message isn't cleared. * Display problems when the 'ambiwidth' and 'emoji' options are not set properly or the terminal doesn't behave as expected. * :packadd does not work the same when used early or late. * Using freed memory when parsing 'printoptions' fails. * Using freed memory with "wincmd p". (Dominique Pelle) * Cannot use empty dictionary key, even though it can be useful. * New regexp engine does not work properly with EBCDIC. * Not all output of an external command is read.- Updated to revision 1691, fixes the following problems * When reading JSON from a channel all readahead is used. * channel_get_all() does multiple allocations. * When writing buffer lines to a pipe Vim may block. * Completion doesn't work well for a variable containing "#". * When help exists in multiple languages, adding @ab while "ab" is the default help language is unnecessary. * The Dvorak support is a bit difficult to install. * The justify plugin has to be copied or sourced to be used. * The editexisting plugin has to be copied or sourced to be used. * The swapmous plugin has to be copied or sourced to be used. * The shellmenu plugin has to be copied or sourced to be used. * A reference to the removed file_select plugin remains. * Coverity: copying value of v_lock without initializing it. * Coverity warns for not checking name length (false positive). * Coverity warns for fixed size buffer length (false positive). * Coverity: no check for NULL. * README text is slightly outdated. * There is no easy way to get all the information about a match. * When running tests $HOME/.viminfo is written. * The channel close_cb option does not work. * MzScheme does not support partial. * Ruby interface has inconsistent coding style. * Can't compile with the conceal feature but without multi-byte. * When switching to a new buffer and an autocommand applies syntax highlighting an ml_get error may occur.- Updated to revision 1665, fixes the following problems * When 'F' is in 'shortmess' the prompt for the encryption key isn't displayed. * When binding a function to a dict the reference count is wrong. * Invoking garbage collection may cause a double free. * Crash when an autocommand changes a quickfix list. * Handling emoji characters as full width has problems with backwards compatibility. * Terminating file name has side effects. * Using string() on a partial that exists in the dictionary it binds results in an error. * When a dict contains a partial it can't be redefined as a function. * Using Python vim.bindeval() on a partial doesn't work. * Using freed memory after setqflist() and ":caddbuffer". * Compiler has a problem copying a string into di_key[]. * The matchit plugin needs to be copied to be used. * Quickfix test fails. * Old style test for fnamemodify(). * Users who loaded matchit.vim manually have to change their startup. * Crash when using expand('%:S') in a buffer without a name. * remote_expr() hangs. * Crash when using partial with a timer. * On Unix in a terminal: channel messages are not handled right away. * A plugin does not know when VimEnter autocommands were already triggered. * has('patch-7.4.1') doesn't work. * No test for special characters in channel eval command. * No test for an invalid Ex command on a channel. * Crash in :cgetexpr. * Crash when calling job_start() with a NULL string.- Updated to revision 1635, fixes the following problems * Quickfix code using memory after being freed. * Using channel timeout instead of request timeout. * Timers don't work on Unix. * Not checking for failed open(). * Memory leak when out of memory. * When starting the GUI fails a swap file is left behind. * Timer with an ":echo" command messes up display. * Although emoji characters are ambiguous width, best is to treat them as full width. * Catching exception that won't be thrown. * Having type() handle a Funcref that is or isn't a partial differently causes problems for existing scripts. * Comparing a function that exists on two dicts is not backwards compatible. * string() doesn't handle a partial. * Contents file is only for Amiga distro. * Compiler warnings for non-virtual destructor. * The versplit feature makes the code uneccessary complicated. * Can't build with small features. * Still can't build with small features. * Still quickfix test in old style. * Build fails with tiny features. * Malformed channel request causes a hang. * When a JSON message is split it isn't decoded. * Starting job with output to buffer changes options in the current buffer. * When 'fileformats' is set in the vimrc it applies to new buffers but not the initial buffer. * Emoji characters are not considered as a kind of word character. * Channel test doesn't work with Python 2.6. * Channel demo doesn't work with Python 2.6. * All Channels share the message ID, it keeps getting bigger. * Can't get info about a channel. * Trying to close file descriptor that isn't open. * Missing changes to structs. * Channel out_cb and err_cb are not tested. * 64-bit Compiler warning. * Handling emoji characters as full width has problems with backwards compatibility. * Unicode table for double width is outdated. * Compiler doesn't understand switch on all enum values. * List of test targets is outdated. * If the help tags file was removed "make install" fails. * Vertical movement after CTRL-A ends up in the wrong column. * Channel test is a bit flaky.- Updated to revision 1591, fixes the following problems * Crash when using function reference. * Using ":call dict.func()" where the function is a partial does not work. * Get E923 when using function(dict.func, [], dict). * Warning for unitinialized variable. * Partial is not recognized everywhere. * Nesting partials doesn't work. * Compiler warnings with 64 bit compiler. * Old style test for quickfix. * Combining dict and args with partial doesn't always work. * Warning for shadowed variable. * The quickfix title is truncated.- Updated to revision 1579, fixes the following problems * Passing cookie to a callback is clumsy. * Dict options with a dash are more difficult to use. * Missing update to proto file. * ":helptags ALL" crashes. * An empty list in function() causes an error. * Crash when assert_equal() runs into a NULL string. * Crash in assert_fails(). * Using CTRL-] in help on option in parentheses doesn't work. * Using old style tests for quickfix. * There is no way to avoid the message when editing a file. * No test for ":help". * Setting 'compatible' in test influences following tests. * Tests get stuck at the more prompt. * ":undo 0" does not work. * Write error of viminfo file is not handled properly. * Cannot pass "dict.Myfunc" around as a partial. * There is no way to invoke a function later or periodically.- Updated to revision 1558, fixes the following problems * Using "ever" for packages is confusing. * Specifying buffer number for channel not implemented yet. * MS-Windows job_start() closes wrong handle. * Compiler warning for unitinialized variable. * MS-Windows channel leaks file descriptor. * Using feedkeys() with an empty string disregards 'x' option. * Compiler warning for shadowed variable. * The feedkeys test has a one second delay. * Cannot re-use a channel for another job. * Too many feature flags for pipes, jobs and channels. * Selection with the mouse does not work in command line mode. * Too much code in eval.c. * Channel test is a bit flaky. * Missing job_info(). * job_start() with a list is not tested. * Channel log methods are not tested. * On Win32 escaping the command does not work properly. * GTK3: horizontal cursor movement in Visual selection not good. * Sticky type checking is more annoying than useful. * Getting a cterm highlight attribute that is not set results in the string "-1". * Two tests fail. * Cannot load packages early. * Cannot generate help tags in all doc directories. * ":colorscheme" does not use 'packpath'. * ":runtime" does not use 'packpath'. * Completion for :colorscheme does not use 'packpath'. * List of test targets incomplete. * "make install" changes the help tags file, causing it to differ from the repository. * Windows cannot be identified. * It is not easy to find out what windows display a buffer.- Switch back to GTK+2 because GTK+3 interface seems to be slower.- Updated to revision 1525, fixes the following problems * Statusline highlighting is sometimes wrong. * "J" fails if there are not enough lines. * Channel output to file not implemented yet. * Channel test is a bit flaky. * Channel with disconnected in/out/err is not supported. * Channel test: Waiting for a file to appear doesn't work. * Cannot write channel err to a buffer. * On a high resolution screen the toolbar icons are too small.- Updated to revision 1510, fixes the following problems * Crash when starting a job fails. * Keeping both a variable for a job and the channel it refers to is a hassle. * Channel test fails on AppVeyor.- Updated to revision 1506, fixes the following problems * No error message when :packadd does not find anything. * Garbage collection with an open channel is not tested. * Writing last-but-one line of buffer to a channel isn't implemented yet. * Crash when using ch_getjob(). * No test for reading last-but-one line. * When channel log is enabled get too many "looking for messages" log entries. * Job cannot read from a file.- Updated to revision 1498, fixes the following problems * ":loadplugin" is not optimal, some people find it confusing. * Not using key when result from hangul_string_convert() is NULL. * "inline" is not supported by old MSVC. * Compiler warning for unused function. * Visual-block shift breaks multi-byte characters. * No command line completion for ":packadd". * Wrong callback invoked for zero-id messages. * clr_history() does not work properly. * Crash when built with GUI but it's not active. * Cursor drawing problem with GTK 3. * Error for locked item when using json_decode().- Updated to revision 1485, fixes the following problems * When using hangulinput with utf-8 a CSI character is misintepreted. * Function arguments marked as unused while they are not. * Test_reltime is flaky, it depends on timing. * ":loadplugin" doesn't take care of ftdetect files. * No test for ":loadplugin". * Cannot add a pack direcory without loading a plugin. * "timeout" option not supported on ch_eval*(). * A one-time callback is not used for a raw channel. * Channel "err-io" value "out" is not supported. * Job input from buffer is not implemented.- Updated to revision 1474, fixes the following problems * Sort test doesn't test with "1" argument. * Channel test sometimes fails, especially on OS/X. * Coverity reports missing restore. * Missing out-of-memory check. And Coverity warning. * Can't build without the autocommand feature. * Compiler warnings without the float feature.- Updated to revision 1467, fixes the following problems * Error when reading fails uses wrong errno. Keeping channel open after job stops results in test failing. * The "out-io" option for jobs is not implemented yet. * When encoding JSON, turning NaN and Infinity into null without giving an error is not useful. * JSON encoding doesn't handle surrogate pair. * Can't get buffer number of a channel. * Using empty name instead of no name for channel buffer. * Memory corruption when 'encoding' is not utf-8. * Crash when using json_decode(). * Memory leak when using ch_read(). * JSON tests fail if 'encoding' is not utf-8. * Json encoding still fails when encoding is not utf-8. * Vim hangs when a channel has a callback but isn't referenced. * Test 87 fails with Python 3.5. * Opening a channel with select() is not done properly. * When a JSON channel has a callback it may never be cleared. * When the argument of sort() is zero or empty it fails.- Updated to revision 1421, fixes the following problems * When calling ch_close() the close callback is invoked, even though the docs say it isn't. * Using "u_char" intead of "char_u", which doesn't work everywhere. * Tests slowed down because of the "not a terminal" warning. * May free a channel when a callback may need to be invoked.- Disable sniff support, its unmaintained.- Updated to revision 1410, fixes the following problems * The close-cb option is not implemented yet. * Perl eval doesn't work properly on 64-bit big-endian machine. * Having 'autochdir' set during startup and using diff mode doesn't work. * GTK 3 is not supported. * Completion menu flickers. * Leaking memory in cs_print_tags_priv(). * json_encode() does not handle NaN and inf properly. * Leaking memory in cscope interface.- Updated to revision 1397, fixes the following problems * When the Job exit callback is invoked, the job may be freed too soon. * Starting a job hangs in the GUI. * Can't sort inside a sort function.- Drop vim-7.1.314-CVE-2009-0316-debian.patch, Python 2.7 has the appropriate fix.- Updated to revision 1385, fixes the following problems * Job and channel options parsing is scattered. * Channel test ch_sendexpr() times out. * Can't remove a callback with ch_setoptions(). * Channels don't have a queue for stderr. * X11 GUI callbacks don't specify the part of the channel. * Channel read implementation is incomplete. * Calling a Vim function over a channel requires turning the arguments into a string. * ch_setoptions() cannot set all options. * Can't change job settings after it started. * The job exit callback is not implemented. * Can't get the job of a channel. * It is not easy to use a set of plugins and their dependencies.- Updated to revision 1353, fixes the following problems * Compiler warnings in build with -O2. * When there is any error Vim will use a non-zero exit code. * When the test server fails to start Vim hangs. * When the port isn't opened yet when ch_open() is called it may fail instead of waiting for the specified time. * The test script lists all functions before executing them.- Updated to revision 1345, fixes the following problems * Crash when using channel that failed to open. * Crash when closing the channel in a callback. * Channel test fails on non-darwin builds. * Channel NL mode is not supported yet. * It's difficult to add more arguments to ch_sendraw() and ch_sendexpr(). * Can't compile with +job but without +channel.- Updated to revision 1328, fixes the following problems * Cursor changes column with up motion when the matchparen plugin saves and restores the cursor position. (Martin Kunev) * "\%1l^#.*" does not match on a line starting with "#". * Channel with pipes doesn't work in GUI. * Crash when unletting the variable that holds the channel in a callback function. * Can't compile with +job but without +channel.- Updated to revision 1294, fixes the following problems * copy() and deepcopy() fail with special variables. * Encoding {'key':} to JSON doesn't give an error. * assert_false(v:false) reports an error. * When jsonencode() fails it still returns something. * jsonencode() is not producing strict JSON. * Crash when evaluating the pattern of ":catch" causes an error. * The job feature isn't available on MS-Windows. * ch_open() with a timeout doesn't work correctly. * ch_sendexpr() does not use JS encoding. - Remove vim-7.3-diff_check.patch- Updated to revision 1194, fixes the following problems * New lines in the viminfo file are dropped. * Old style tests for the argument list. * Generated function prototypes still have __ARGS(). * Wrong argument to assert_exception() causes a crash. * Illegal memory access when using :copen and :cclose. * When running gvim in the foreground some icons are missing. * Recognizing does not work when the language is Turkish. * Using searchpair() with a skip expression that uses syntax highlighting sometimes doesn't work. * Cannot define keyword characters for a syntax file. * Can't sort on floating point numbers. * Default features are conservative. * Conflict for "chartab". * Using the local value of 'errorformat' causes more problems than it solves. * 'langmap' applies to the first character typed in Select mode. * Langmap test fails with normal build. * Autocommands triggered by quickfix cannot always get the current title value. * No support for JSON. * Build with normal features fails. * Coverity warns for NULL pointer and ignoring return value. * type() does not work for v:true, v:none, etc. * Automatically generated function prototypes use __ARGS. * No error for jsondecode('"'). * ":argadd" without argument is supposed to add the current buffer name to the arglist. * Missing error number in MzScheme. * Expressions "0 + v:true" and "'' . v:true" cause an error. * No tests for "is" and "isnot" with the new variables. * This doesn't give the right result: eval(string(v:true)). * No test for new behavior of v:true et al. * The +channel feature is not in :version output. * empty() doesn't work for the new special variables. * test_writefile and test_viml do not delete the tempfile. * Crash with invalid argument to glob2regpat(). * free_tv() can't handle special variables. * Error messages for security context are hard to translate. * The channel feature isn't working yet. * Can't build with FEAT_EVAL but without FEAT_MBYTE. * Compiler warning for not using return value of fwrite().- Updated to revision 1130, fixes the following problems * Repeating CTRL-A doesn't work. * No tests for :hardcopy and related options. * When making a change while need_wait_return is set there is a two second delay. * With 'rightleft' and concealing the cursor may move to the wrong position. * Vim can create a directory but not delete it. * When using ":next" with an illegal file name no error is reported. * Using {ns} in variable name does not work. (lilydjwg) * delete() does not work well with symbolic links. * delete(x, 'rf') does not delete files starting with a dot. * No longer get "." and ".." in directory list. * argidx() has a wrong value after ":%argdelete". (Yegappan Lakshmanan) * delete(x, 'rf') fails if a directory is empty. (Lcd) * Using ":argadd" when there are no arguments results in the second argument to be the current one. (Yegappan Lakshmanan) * There is no perleval(). * Can only get the directory of the current window. * Python None value can't be converted to a Vim value. * Memory leak in :vimgrep.- Updated to revision 1087, fixes the following problems * Wrong way to check for unletting internal variables. * The Tcl interface can't be loaded dynamically on Unix. * Crash when using an invalid command. * CTRL-A does not work well in right-left mode. * Using "." to repeat CTRL-A in Visual mode increments the wrong numbers. * The CTRL-A and CTRL-X commands do not update the '[ and '] marks. * Crash with an extremely long buffer name. * CTRL-A and CTRL-X work badly with blockwise visual selection- Updated to revision 1066, fixes the following problems * Segfault when unletting "count". * Illegal memory access with weird syntax command. (Dominique Pelle) * Typos in the :options window. * Compiler warning for ignoring return value of fwrite(). * When a spell file has single letter compounding creating suggestions takes an awful long time.- Updated to revision 1046, fixes the following problems * The fix in patch 7.3.192 is not tested. * When a symbolic link points to a file in the root directory, the swapfile is not correct. * Vim overwrites the value of $PYTHONHOME. * The local value of 'errorformat' is not used for ":lexpr" and ":cexpr". * The column is not restored properly when the matchparen plugin is used in Insert mode and the cursor is after the end of the line. * When there is a backslash in an option ":set -=" doesn't work. * An Ex range gets adjusted for folded lines even when the range is not using line numbers. * Using "q!" when there is a modified hidden buffer does not unload the current buffer, resulting in the need to abandon it again. * g-CTRL-G shows the word count, but there is no way to get the word count in a script.- Updated to revision 1004, fixes the following problems * searchpos() always starts searching in the first column, which is not what some people expect. (Brett Stahlman) * Leaking memory when hash_add() fails. Coverity error 99126.- Updated to revision 979, fixes the following problems * When pasting on the command line line breaks result in literal characters. This makes pasting a long file name difficult. * When using :diffsplit the cursor jumps to the first line. * Using ":sort" on a very big file sometimes causes text to be corrupted. (John Beckett) * test_cdo fails when using another language than English. * When changing the crypt key the blocks read from disk are not decrypted.- Updated to revision 972, fixes the following problems * Test 87 doesn't work in a shadow directory. * Configure doesn't work with a space in a path. * test86 and test87 are flaky in Appveyor. * Rare crash in getvcol(). (Timo Mihaljov) * The asin() function can't be used. * Memory leak when there is an error in setting an option.- Updated to revision 963, fixes the following problems * Crash when dragging with the mouse. * Segfault reading unitialized memory. * X11 and GTK have moure mouse buttons than Vim supports. * Memory leak when encountering a syntax error. * vt52 terminal codes are not correct. * There is no way to ignore case only for tag searches. * test_tagcase breaks for small builds. * Writing tests for Vim script is hard. * New style testing is incomplete. * Missing changes in source file. * Test_listchars fails with MingW. (Michael Soyka) * Can't build when the insert_expand feature is disabled. * When using 'colorcolumn' and there is a sign with a fullwidth character the highlighting is wrong. (Andrew Stewart) * v:errors is not initialized. * Sorting number strings does not work as expected. (Luc Hermitte) * 'lispwords' is tested in the old way. * When a test script navigates to another buffer the .res file is created with the wrong name. * When using Lua there may be a crash. (issue #468) * Vim doesn't recognize .pl6 and .pod6 files. * A few more file name extensions not recognized. * Test_tagcase fails when using another language than English. * Vim checks if the directory "$TMPDIR" exists. * When setting 'term' the clipboard ownership is lost. * Test107 fails in some circunstances. * Cannot run the tests with gvim. Cannot run individual new stests. * test_listlbr_utf8 sometimes fails.- Updated to revision 935, fixes the following problems * Test 94 fails on some systems. * test_utf8 has confusing dummy command. * Crash when using longest completion match.- Updated to revision 930, fixes the following problems * When a BufLeave autocommand changes folding in a way it syncs undo, undo can be corrupted. * Python interface can produce error "vim.message' object has no attribute 'isatty'". * Libraries for dynamically loading interfaces can only be defined at compile time. * Compiler complains about type punned pointer. * t_Ce and t_Cs are documented but not supported. (Hirohito Higashi) * Wrong indenting for C++ constructor. * No utf-8 support for the hangul input feature. * New compiler warning: logical-not-parentheses * When removing from 'path' and then adding, a comma may go missing. (Malcolm Rowe) * When running out of memory while copying a dict memory may be freed twice. (ZyX) * Compiler warning for comparing signed and unsigned. * A digit in an option name has problems. * The dll options are not in the options window. * The rubydll option is not in the options window. * Missing proto file update. (Randall W. Morris) * Leaking memory with ":helpt {dir-not-exists}". * Prototypes not always generated. * User may yank or put using the register being recorded in. * Completing the longest match doesn't work properly with multi-byte characters. * Ruby crashes when there is a runtime error. * A clientserver message interrupts handling keys of a mapping. * "gv" after paste selects one character less if 'selection' is "exclusive". * MS-Windows: Most users appear not to like the window border. - Refresh vim-7.3-sh_is_bash.patch- Updated to revision 898, fixes the following problems * Build failure when using dynamic python but not python3. * Indentation of array initializer is wrong. * On MS-Windows the iconv DLL may have a different name. * C indenting is wrong below a "case (foo):" * vimrun.exe is picky about the number of spaces before -s. * Custom command line completion does not work for a command containing digits. * Editing a URL, which netrw should handle, doesn't work. * Freeze and crash when there is a sleep in a remote command. (Karl Yngve Lervåg) * The 'fixendofline' option is set on with ":edit".- Updated to revision 889, fixes the following problems * Crash when changing the 'tags' option from a remote command. (Benjamin Fritz) * 'smarttab' is also effective when 'paste' is enabled. (Alexander Monakov) * May get into an invalid state when using getchar() in an expression mapping. * Vim leaks memory, when 'wildignore' filters out all matches. * Compiler warning for unused variable. (Tony Mechelynck) * Not obvious how to contribute. * ":find" sometimes fails. (Excanoe) * Coverity error for clearing only one byte of struct. * Can't see line numbers in nested function calls. * Test 49 fails. * When leaving the command line window with CTRL-C while a completion menu is displayed the menu isn't removed. * Block-mode replace works characterwise instead of blockwise after column 147. (Issue #422) * When doing an upwards search without wildcards the search fails if the initial directory doesn't exist. * Using uninitialized memory for regexp with back reference. (Dominique Pelle) * The OptionSet autocommands are not triggered from setwinvar(). * Triggering OptionSet from setwinvar() isn't tested.- Updated apparmor.vim (taken from AppArmor 2.10.0) * add support for the "ib" and "mpls" network keywords- Updated to revision 865, fixes the following problems * GTK: font glitches for combining characters * "zt" still doesn't work well with filler lines. (Gary Johnson) * Dragging the current tab with the mouse doesn't work properly. * It's a bit clumsy to execute a command on a list of matches. * Vim doesn't recognize all htmldjango files. * Filetype detection is outdated. * pango_shape_full() is not always available. * Still problems with pango_shape_full() not available. * plines_nofill() used without the diff feature.- Updated to revision 854, fixes the following problems * When '#' is in 'isident' the is# comparator doesn't work. * Compiler warning for possible loss of data. * "vi)d" may leave a character behind. * CTRL-A on hex number in Visual block mode is incorrect. * Moving the cursor in Insert mode starts new undo sequence. * does not show up. * Saving and restoring the console buffer does not work properly. * "zt" in diff mode does not always work properly. (Gary Johnson) * Missing information about runtime files.- Updated to revision 843, fixes the following problems * Xxd doesn't have a license notice. * The ruler shows "Bot" even when there are only filler lines missing. (Gary Johnson) * CTRL-A in Visual mode doesn't work properly with "alpha" in 'nrformat'. * After CTRL-V CTRL-A mode isn't updated. (Hirohito Higashi) * With a sequence of commands using buffers in diff mode E749 is given. (itchyny) * Invalid memory access when using "exe 'sc'". * Gcc sanitizer complains about using a NULL pointer to memmove(). * It is not possible to save and restore character search state. * Illegal memory access with "sy match a fold". * Invalid memory access when doing ":call g:". * Invalid memory access when doing ":fun X(". * Invalid memory access in file_pat_to_reg_pat(). * 'linebreak' breaks c% if the last Visual selection was block. (Chris Morganiser, Issue 389) * Invalid memory access in file_pat_to_reg_pat. * Cursor moves after CTRL-A on alphabetic character. * Invalid memory access for ":syn keyword x a[". * Crash when using "syn keyword x c". (Dominique Pelle) * Crash when clicking in beval balloon. (Travis Lebsock) * Resetting 'encoding' when doing ":set all&" causes problems. (Bjorn Linse) Display is not updated. * When expanding `=expr` on the command line and encountering an error, the command is executed anyway. * $HOME in `=$HOME . '/.vimrc'` is expanded too early. * More side effects of ":set all&" are missing. (Björn Linse) * gettabvar() doesn't work after Vim start. (Szymon Wrozynski) * Comparing utf-8 sequences does not handle different byte sizes correctly. * Can't compile without the crypt feature. (John Marriott) - Refresh vim-7.3-diff_check.patch- Updated to revision 803, fixes the following problems * Repeating a change in Visual mode does not work as expected. (Urtica Dioica) * Accessing memory before an allocated block. * Using freed memory when triggering CmdUndefined autocommands. * Test for ":diffoff" doesn't catch all potential problems. * Using "A" in Visual mode while 'linebreak' is set is not tested. * C indent does not support C11 raw strings. (Mark Lodato)- Updated to revision 797, fixes the following problems * Using freed memory and crash. (Dominique Pellej) * Test fails when the autochdir feature is not available. Test output contains the test script. * The buffer list can be very long. * Can only conceal text by defining syntax items. * Can't specify when not to ring the bell. * The 'fixeol' option is not copied to a new window. * Warning from 64 bit compiler. * Crash when using more lines for the command line than 'maxcombine'.- Updated to revision 788, fixes the following problems * CTRL-A and CTRL-X in Visual mode do not always work well. * :diffoff only works properly once. * Behavior of :diffoff is not tested. * Background color response with transparency is not ignored. * Search does not handle multi-byte character at the start position correctly. * 'langmap' is used in command-line mode when checking for mappings. Issue 376. * When using the CompleteDone autocommand event it's difficult to get to the completed items. * It is not possible to avoid using the first item of completion. * Equivalence class for 'd' does not work correctly. * Coverity warns for uninitialized variable. * Using CTRL-A in a line without a number moves the cursor. May cause a crash when at the start of the line. (Urtica Dioica) * Compiler complains about uninitialized variable and clobbered variables. * line2byte() returns one less when 'bin' and 'noeol' are set. * Still a few problems with CTRL-A and CTRL-X in Visual mode. * copy_chars() and copy_spaces() are inefficient. * Using both "noinsert" and "noselect" in 'completeopt' does not work properly. * On some systems automatically adding the missing EOL causes problems. Setting 'binary' has too many side effects. * It is not possible for a plugin to adjust to a changed setting. * snprintf() isn't available everywhere.- Updated to revision 763, fixes the following problems * Appending in Visual mode with 'linebreak' set does not work properly. Also when 'selection' is "exclusive". (Ingo Karkat) * Using CTRL-A in Visual mode does not work well. (Gary Johnson) * It is not easy to count the number of characters. * Cannot detect the background color of a terminal. * When 'conceallevel' is 1 and quitting the command-line window with CTRL-C the first character ':' is erased. * Spelling mistakes are not displayed after ":syn spell". * The request-background termcode implementation is incomplete. * Comment for may_req_bg_color() is wrong. (Christ van Willegen)- Updated to revision 752, fixes the following problems * When setting the crypt key and using a swap file, text may be encrypted twice or unencrypted text remains in the swap file. * The tab menu shows "Close tab" even when it doesn't work. * The cursor line is not always updated for the "O" command. * ml_get error when using "p" in a Visual selection in the last line. * Wrong argument for sizeof(). * In a string "\U" only takes 4 digits, while after CTRL-V U eight digits can be used. * ":1quit" works like ":.quit". (Bohr Shaw) * When using += with ":set" a trailing comma is not recognized. (Issue 365) * Cannot specify a vertical split when loading a buffer for a quickfix command. * "p" in Visual mode causes an unexpected line split. * No tests for Ruby and Perl. * The entries added by matchaddpos() are returned by getmatches() but can't be set with setmatches(). (Lcd) * ":[count]tag" is not always working. (cs86661) * ":cnext" may jump to the wrong column when setting 'virtualedit=all' * For some options two consecutive commas are OK. (Nikolay Pavlov) * It is not obvious how to enable the address sanitizer. * Unicode 8.0 not supported.- Make Perl support dynamic bsc#804070- Updated to revision 729, fixes the following problems * Illegal memory access when there are illegal bytes. * ":let list += list" can change a locked list. * Autocommands triggered by quickfix cannot get the current title value. * Overflow when adding MAXCOL to a pointer. * When 'list' is set Visual mode does not highlight anything in empty lines. (mgaleski) * 0x202f is not recognized as a non-breaking space character. * For indenting, finding the C++ baseclass can be slow. * ":call setreg('"', [])" reports an internal error. * Occasional crash with 'list' set.- Updated to revision 712, fixes the following problems * Out-of-bounds read, dectected by Coverity. * Not freeing memory when encountering an error. * The filename used for ":profile" must be given literally. * Various problems with locked and fixed lists and dictionaries. * E315 when trying to delete a fold. (Yutao Yuan) * Fold can't be opened after ":move". (Ein Brown) * Compiler warning for using uninitialized variable. (Yasuhiro Matsumoto) * Joining an empty list does uneccessary work. * Compiler warning for start_dir unused when building unittests. * Searching for a character matches an illegal byte and causes invalid memory access. (Dominique Pelle) * Can't build with Ruby 2.2. * Window drawn wrong when 'laststatus' is zero and there is a command-line window. (Yclept Nemo) * Undo files can have their executable bit set. * gettext() is called too often. * ":tabmove" does not work as documented. * It is not possible to make spaces visibible in list mode.- Updated to revision 694, fixes the following problems * When starting several Vim instances in diff mode, the temp files used may not be unique. (Issue 353) * When there are illegal utf-8 characters the old regexp engine may go past the end of a string. * "zr" and "zm" do not take a count. * There is no way to use a different in Replace mode for a terminal. * When "$" is in 'cpo' the popup menu isn't undrawn correctly. (Issue 166) * Memory access errors when changing indent in Ex mode. Also missing redraw when using CTRL-U. (Knil Ino) * Can't build with MzScheme. * Session file is not correct when there are multiple tab pages. * Running tests changes the .viminfo file.- Updated to revision 683, fixes the following problems * When using --remote the directory may end up being wrong. * CTRL-W in Insert mode does not work well for multi-byte characters. * MS-Windows: When Vim is minimized the window height is computed incorrectly. * The search highlighting and match highlighting replaces the cursorline highlighting, this doesn't look good. * Typo in the vimtutor command.- Updated to revision 676, fixes the following problems * When 'ruler' is set the preferred column is reset. (Issue 339) * Using freed memory when g:colors_name is changed in the colors script. (oni-link) * Using "0 CTRL-D" in Insert mode may have CursorHoldI interfere. (Gary Johnson) * When 'M' is in the 'cpo' option then selecting a text object in parenthesis does not work correctly. * When using netbeans a buffer is not found in another tab. * When 'compatible' is reset 'numberwidth' is set to 4, but the effect doesn't show until a change is made. * 'linebreak' does not work properly with multi-byte characters. * There is a chance that Vim may lock up. * 'colorcolumn' isn't drawn in a closed fold while 'cursorcolumn' is. (Carlos Pita) * Can't use a glob pattern as a regexp pattern. * When netbeans is active the sign column always shows up. * Using 'cindent' for Javascript is less than perfect. * Warning for shadowing a variable. * When completing a shell command, directories in the current directory are not listed. * The first syntax entry gets sequence number zero, which doesn't work. (Clinton McKay) * Missing changes in one file. * When a FileReadPost autocommand moves the cursor inside a line it gets moved back. - Refresh vim73-no-static-libpython.patch- Updated to revision 658, fixes the following problems * The tabline menu was using ":999tabnew" which is now invalid. * When using "gf" escaped spaces are not handled. * Stratus VOS doesn't have sync(). * When splitting the window in a BufAdd autocommand while still in the first, empty buffer the window count is wrong. * ":bufdo" may start at a deleted buffer. * Compiler complains about ignoring return value of fwrite(). (Michael Jarvis) * Configure check may fail because the dl library is not used. * Can't match "%>80v" properly for multi-byte characters. * Xxd lacks a few features. * Insert mode completion with complete() may have CTRL-L work like CTRL-P. * glob() and globpath() cannot include links to non-existing files. (Charles Campbell) * Text deleted by "dit" depends on indent of closing tag. (Jan Parthey) * Missing changes for glob() in one file. * Compiler warnings for pointer mismatch. * 'formatexpr' is evaluated too often.- Updated to revision 640, fixes the following problems * When using Insert mode completion combined with autocommands the redo command may not work. * The default conceal character is documented to be a space but it's initially a dash. (Christian Brabandt) * 7.4.592 breaks the netrw plugin, because the autocommands are skipped. * Marks are not restored after redo + undo. * If no NL or CR is found in the first block of a file then the 'fileformat' may be set to "mac". (Issue 77) * A search with end offset gets stuck at end of file. (Gary Johnson) * Incorrectly read the number of buffer for which an autocommand should be registered. * Can't build with Lua 5.3 on Windows. * Combination of linebreak and conceal doesn't work well. * After deleting characters in Insert mode such that lines are joined undo does not work properly. (issue 324)- Updated to revision 629, fixes the following problems * For complicated list and dict use the garbage collector can run out of stack space. * Syntax error. * The NFA engine does not implement the 'redrawtime' time limit. * Vim hangs when freeing a lot of objects. * Wrong ":argdo" range does not cause an error. * luaV_setref() is missing a return statement. (Ozaki Kiichi) * luaV_setref() not returning the correct value. * Compiler warning for unitinialized variable. (Tony Mechelynck) * Returning 1 in the wrong function. (Raymond Ko) * Compiler warning for unused argument. * Crash with pattern: \(\)\{80000} (Dominique Pelle) * May leak memory or crash when vim_realloc() returns NULL. * Possible NULL pointer dereference. * The last screen cell is not updated. * Compiler warning for variable might be clobbered by longjmp. * Coverity warning for Out-of-bounds read. - Remove vim-speedup-gc.patch, fixed upstream- Updated to revision 608, fixes the following problems * Compiler warnings for unitinialized variables. (John Little) * Can't match "%>80v" properly. (Axel Bender) * Range for :bdelete does not work. (Ronald Schild) * Parallel building of the documentation html files is not reliable. * Conceal does not work properly with 'linebreak'. (cs86661) * ":0argedit foo" puts the new argument in the second place instead of the first. * Using ctrl_x_mode as if it contains flags. * test_listlbr_utf8 fails when the conceal feature is not available. * When doing ":e foobar" when already editing "foobar" and 'buftype' is "nofile" the buffer is cleared. (Xavier de Gaye) * Crash when searching for "x\{0,90000}". (Dominique Pelle) * Using a block delete while 'breakindent' is set does not work properly. * The test_command_count test fails when using Japanese. * Tiny build doesn't compile. (Ike Devolder) * Cannot change the result of systemlist(). * Out-of-memory error. * Memory wasted in struct because of aligning. * It is not possible to have feedkeys() insert characters. * ":set" does not accept hex numbers as documented. * 'foldcolumn' may be set such that it fills the whole window, not leaving space for text. * Running tests changes viminfo. * The # register is not writable, it cannot be restored after jumping around. * May crash when using a small window. * Compiler warnings for unused variables.- Add vim-speedup-gc.patch to improve garbage collection performance. Based on https://github.com/neovim/neovim/pull/1761 (boo#899747)- Modify vim-7.3-filetype_changes.patch to expand tabs when editing * .changes files (bnc#900839)- Update suse.vimrc to stop remembering file positions for git commit cases. This fixes bnc#538369 and based on msys commits 1ef258e and 65ffc90.- Updated to revision 580, fixes the following problems * Ex range handling is wrong for buffer-local user commands. * Segfault with wide screen and error in 'rulerformat'. (Ingo Karkat) * No test for replacing on a tab in Virtual replace mode. * FEAT_OSFILETYPE is used even though it's never defined. * Ranges for arguments, buffers, tabs, etc. are not checked to be valid but limited to the maximum. This can cause the wrong thing to happen. * :argdo, :bufdo, :windo and :tabdo don't take a range. * Non-ascii vertical separater characters are always redrawn. * Giving an error for ":0wincmd w" is a problem for some plugins. * Having CTRL-C interrupt or not does not check the mode of the mapping. (Ingo Karkat) * Building with dynamic library does not work for Ruby 2.2.0 * Can't build with tiny features. (Ike Devolder) * Address type of :wincmd depends on the argument. * Mapping CTRL-C in Visual mode doesn't work. (Ingo Karkat) * No error for eval('$'). * Unicode character properties are outdated. * Redrawing problem with 'relativenumber' and 'linebreak'. * Matching with a virtual column has a lot of overhead on very long lines. (Issue 310) * Using getcurpos() after "$" in an empty line returns a negative number. * Wrong cursor positioning when 'linebreak' is set and lines wrap. * ":52wincmd v" still gives an invalid range error. (Charles Campbell)- Updated to revision 560, fixes the following problems * Tests fail with small features plus Python. * Crash when computing buffer count. Problem with range for user commands. Line range wrong in Visual area. * Cannot build with tiny and small features. (Taro Muraoka) * Crash when doing a range assign. * Using a range for window and buffer commands has a few problems. Cannot specify the type of range for a user command. * Since patch 7.4.232 "1,3s/\n//" joins two lines instead of three. (Eliseo Martínez) Issue 287 * Warnings for unused arguments when compiling with a combination of features. * Highlighting for multi-line matches is not correct. * Repeated use of vim_snprintf() with a number. * Using "vit" does not select a multi-byte character at the end correctly. * Function name not recognized correctly when inside a function. * curs_rows() function is always called with the second argument false. * "ygn" may yank too much. (Fritzophrenic) Issue 295. * Langmap applies to Insert mode expression mappings. * Various small issues. * Missing part of patch 7.4.519. * test_close_count may fail for some combination of features. * Failed commands in Python interface not handled correctly. * One more small issue. * When the X server restarts Vim may get stuck. * Appending a block in the middle of a tab does not work correctly when virtualedit is set. * Memory leak using :wviminfo. Issue 296.- use SUSE LINUX GmbH everywhere- Updated to revision 537, fixes the following problems * With a wrapping line the cursor may not end up in the right place. (Nazri Ramliy) * Using status line height in width computations. * Crash when using syntax highlighting. * Sun PCK locale is not recognzed. * When using "vep" a mark is moved to the next line. (Maxi Padulo, Issue 283) * Specifying wrong buffer size for GetLongPathName(). * When the X11 server is stopped and restarted, while Vim is kept in the background, copy/paste no longer works. (Issue 203) * When using ":ownsyntax" spell checking is messed up. (Issue 78) * map() leaks memory when there is an error in the expression. * matchstr() fails on long text. Daniel Hahler) * Still confusing regexp failure and NFA_TOO_EXPENSIVE. * Crash when using matchadd() (Yasuhiro Matsumoto) * No test for what 7.4.517 fixes. * Many commands take a count or range that is not using line numbers. * Comments about parsing an Ex command are wrong. * When using 'incsearch' "2/pattern/e" highlights the first match. * ":hardcopy" leaks memory in case of errors. * Warnings when compiling if_ruby.c. * Can't build with tiny features. * Test 63 fails when using a black&white terminal. * Value of v:hlsearch reflects an internal variable.- Updated to revision 516, fixes the following problems * When generating ja.sjis.po the header is not correctly adjusted. * Users are not aware their encryption is weak. * "-fwrapv" argument breaks use of cproto. * Generating proto for if_ruby.c uses type not defined elsewhere. * Crash because reference count is wrong for list returned by getreg(). * Memory access error. (Dominique Pelle) * In a help buffer the global 'foldmethod' is used. (Paul Marshall) * Completing a function name containing a # does not work. Issue 253.- Updated to revision 507, fixes the following problems * Setting the local value of 'backupcopy' empty gives an error. (Peter Mattern) * Compiler warning. * Crash when expanding a very long string. * CTRL-W } does not open preview window. (Erik Falor) * 'linebreak' does not work well together with Visual mode. * Issue 26: CTRL-C does not interrupt after it was mapped and then unmapped. * The "precedes" entry in 'listchar' will be drawn when 'showbreak is set and list is not. * Cursor movement is incorrect when there is a number column/sign/fold column and 'sbr' is displayed. * Can't compile on a system where Xutf8SetWMProperties() is not in the X11 library. Issue 265. * When using ":%diffput" and the other file is empty an extra empty line remains. * Using byte length instead of character length for 'showbreak'. * When 'balloonexpr' results in a list, the text has a trailing newline. (Lcd) * A 0x80 byte is not handled correctly in abbreviations. * Abbreviations don't work. (Toothpik) * Check for writing to a yank register is wrong. * ":sign jump" may use another window even though the file is already edited in the current window. * test_mapping fails for some people. * Cursor movement still wrong when 'lbr' is set and there is a number column. (Hirohito Higashi) * Cannot specify the buffer to use for "do" and "dp", making them useless for three-way diff. * When winrestview() has a negative "topline" value there are display errors. * In Insert mode, after inserting a newline that inserts a comment leader, CTRL-O moves to the right. (ZyX) Issue 57. * A TextChanged autocommand is triggered when saving a file. (William Gardner) * Cursor shape is wrong after a CompleteDone autocommand. * XPM isn't used correctly in the Cygwin Makefile. * With some regexp patterns the NFA engine uses many states and becomes very slow. To the user it looks like Vim freezes. * substitute() can be slow with long strings. * Test 72 still fails once in a while. * Typo in file pattern. * Language mapping also applies to mapped characters. * Cannot append a list of lines to a file.- Updated apparmor.vim (taken from AppArmor 2.9.0) * add support for 'hat' keyword * fix highlighting of comments in alias and link rules/bin/sh/bin/shgvim-basegvim-enhancedxxds390zl36 1700728380  9.0.2103-150500.20.6.19.0.2103-150500.20.6.19.0.2103-150500.20.6.19.0.2103-150500.20.6.19.0.2103-150500.20.6.19.0.2103-150500.20.6.19.0.2103-150500.20.6.19.0.2103-150500.20.6.1 vivimgvimrcegviewegvimeviewevimgexgvigviewgvimgvimdiffrgviewrgvimvivimgvim.desktopgvimREADME.Japanese-XIMgui_x11.txtgvimrc_example.vimsuse.gvimrcgvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.svg/etc/alternatives//etc//usr/bin//usr/share/applications//usr/share/doc/packages//usr/share/doc/packages/gvim//usr/share/icons/hicolor/128x128/apps//usr/share/icons/hicolor/24x24/apps//usr/share/icons/hicolor/256x256/apps//usr/share/icons/hicolor/32x32/apps//usr/share/icons/hicolor/48x48/apps//usr/share/icons/hicolor/512x512/apps//usr/share/icons/hicolor/64x64/apps//usr/share/icons/hicolor/96x96/apps//usr/share/icons/hicolor/scalable/apps/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.suse.de/SUSE:Maintenance:31598/SUSE_SLE-15-SP5_Update/c05e327292909febbe456f2bc446ed30-vim.SUSE_SLE-15-SP5_Updatedrpmxz5s390x-suse-linux cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.0.2103-150500.20.6.1.s390x/etc/alternatives/vi' (No such file or directory)cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.0.2103-150500.20.6.1.s390x/etc/alternatives/vim' (No such file or directory)ASCII textELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, interpreter /lib/ld64.so.1, BuildID[sha1]=326f2d5df1b94ce8fd8b07bbbfb2e7751362b724, for GNU/Linux 3.2.0, strippeddirectoryPNG image data, 128 x 128, 8-bit/color RGBA, non-interlacedPNG image data, 24 x 24, 8-bit/color RGBA, non-interlacedPNG image data, 256 x 256, 8-bit/color RGBA, non-interlacedPNG image data, 32 x 32, 8-bit/color RGBA, non-interlacedPNG image data, 48 x 48, 8-bit/color RGBA, non-interlacedPNG image data, 512 x 512, 8-bit/color RGBA, non-interlacedPNG image data, 64 x 64, 8-bit/color RGBA, non-interlacedPNG image data, 96 x 96, 8-bit/color RGBA, non-interlacedSVG Scalable Vector Graphics image++R R*RR,R(R#R"R R.RRRR RRRRRRR RR%R$RRRRRRRRRR!R+R-R)RR RRR&R'R PPP P PP PPPPPPPPPP P KpzSl \Igutf-8ccd985f685a1d35cd526de3ee19c6a1b8e6f5f2aa8e6b99774e3ab4a771b4a61?7zXZ !t/?R]"k%{J #$xd?L6=[2xPգwq1&aRۣϱH/R}D&$N,I["BNX0dWbFS*6Vuqm>{ڐ#MԘxxYD8 ;Z q( i~R)ɱ<5/p9h^f͡Ŷ Ŧ/h}K6\ȫ]Y^PYL V 2TS_6ll?+aWނT{z6Vw_U* Kd46j l T . Ql/`OE~7>d`Ԙ3V/ɾE_.lȇI { }! 9-ӹȨwA\3"ȾbZ$觹:'iWiۆ?Kfr}5,$$Z^hO=5GʆE%T`&AYΗdҁW+%3YqԮc$p+B;00y+1qX1wcc޴ ,hhņbtϰ@WܯJḑH1/Beo =INw1Y)]!4Xnۡރ6ZX{!w} ZRAfڭG}`*T'#@ nD EN c=1k=cNSާMUβ]H1iIW(hCԈy$pTˤF{tW-ތl \ yfW|#Bde )y]~kЭ\SHY%怸f4$r싦ecVm3Q& u[Ay}T_)ĖS~8qҭIq =K;˸* FlBtMj<1,ⴡ8gCYHfZ2u( P|jEUc:Gwe]qUtGUtpߦ]3oɲH%YH RōoduvAB`jŕ=@]Ոme6~6* gK:N>NEd+ϚG8aZZKu84#+v  '7&w?Z ! C9f3{+HdmU''M@kW}'1bJ$ v7Wm*"^*It.o "ՅwE l,2I'Fi>.;9×EF$ u_TWѩ>hI@^NeDOR'f>sf^^(| 2°b_1?1!8LvZf"4i+jHBK8/x3ePҁM4WOB [`4AtR*c2`@$ٖTOo2S_͢!nbj௖8}R#%f(JZK'օ꫄ãf۵ ugM3!<2}zN:C$Ϭ/ݏQ-KO;Ka !j5ET:V}#;fWA}14ﾽ$UvLU{Cdrǘέ\KRxE,L@0z501+=@\.hXhWQr2?Kŏ̲͛zm}ŭ}A'tMP9zzS=%=]q OL-I29 RUZ)'&̓Zf9RSg |w,13xKu&"Kz^]E,vzez#ǨG6:Pmi^_GJ=eYabL6@uzH눙0,7Sl5켏Э}!9++=镾R 8 "EI?FJ؝jr jl in}IR:08~'/~"k1tXe?(BG px$}ʌ2.w<ӶzW7{w[vJB upNI:Η;%:y6~vK'exԵ63^xcZX;=Ű)n]cnKm[u+yW8rYEuz =BOh߬5*YnRA!jJq3>K~S'ϯ"(‘J黭 y?| "Old'bZ>~A%"3 RM9Z0`)S`N̨M7V<2// ĀeQ:1 _\bBn۴TE7 p?uVFwycz!&G: >>q۷dK7|M&"D¡mU@o\"vfK+0: Y2kQ#rBTԊh8IH {5-.#bW S">\$ ǿыj,W5\}&P54s$\?nւep DI9!'Ǭey$oO3ݞ,[%eB2PC (%JifJxٛ4{0#+titrW :g D>"ȴN < u$Cư$ȏh;Б_#w\xtDyƉ/m}D_0AH"ȐepL8/D~p?GM- קШXʓX/5֨?/ƧٸG@y^rҊHUy\$/{5=5)af%r4ɣ6]&.o@=ցZ]/nz(vM%Lt8э~]NO"`|:4r.^{fPf$:-dMcK^eDR#r.gZ  4s7e=M7/ l2ޢL/ mkW워. LdYg(ixiF3*Xm֌c&hRo8rb+i|,rY/ _2 ,fh=JX8=-@L2SSciH/mMCzxek>ۅ4(OĂC<fKN(ޝ/J3wT?GT"%6 [#]͘)^%a =y$F"5W8kZq+ӌW葉:-Q&*%XU7u>DeTO߁^,b]SJ1F*cؿr(uTtx&G\˷t)Uy^"""G&#̆LKı?Ѹ woL=8W ?<=$8n,ߴNb?&o ؤZw /~eᥴcџt_BAP` OYa{uU}0` \b,&UwYAGU%G=wY kLB兣iʯ5X^$3~0Ù#B(%kV-7a7ogڐu\+ؚz\o9ko*>k9y,[/4뿽u83VxXV8,=lCUSf?d} -3'U }$DdW_b4/cUC;xwdG2 Y\hI}Y ^XV סe"cZf4 ÃDdF*(k,/Q";Z%qIj(_xϺ20b ZӭQ- e% [yw HD)QXKyaj |$0j(˱ yIk44zQXǸXyNO`L]ë$=.]Bn(~Dj`C?b !gJyG/USvuDK^|` 0Ļc'zRAzl:[2A/f T hE8rjVO0p\4=%g_Tqؙ\QXS͒Z٢Y!g#zslm_*LA`7]UOjGQ"ק+L2u[ 8T?~]:Byn[ \Fd|8>轜h:8}mMyh\ YոT$6⮥!_qêƾ] ⿖5ኩsLi$J1X2.`4j2Y/>e(D &^KqW%3ҍ͎m*gUJ4CS. sU+vF/v衳CaE|GlH֪j`usNw@q&( M;sW9'$z<|F.ȋ?m-&>L8*ŶZgO7ڑl}ܺλYd !q'$Ru<^A+N :8l#>cZmw\^cLJ8F1:]lrF4,)12(GTlbSBXx5X:. HZerhUF]mXN1˭{2 JTٲ-꣪iq`O|6JQ45Ívw"jR>NjCu@X4وc,@zZ^K_h yuȘ"li.5'`Q/n0D1~BY̟ۓ}J rCrQ[vەx|g)0rZT uVz+3[hlL;`ZJ~3CL;wfaQF @Spg}O*"t4c_%+sŌ-,eTv8fɕ@Y(B:P𦅑XN\]æH~̊s:*MAZpE9R OWCVYHyHɰ?6b^.Ś':chX̎^҂sy4aEOgs"-]ǘ[{Pq{ɣAL-sexb-o ~ؾX투*&8*tU "H޺6y7(}SwL,@ _vTmۄ(Bz,rmᕦSUqf$ (]6])ΖtB$O5gmE 'W?O\*e`0?~dfcjh'u>x18X)EAXtgŦ hYE#dTrݥ '_3-2iU=x-݃HBnaB$8qR7ͩuL$l ACmNa$V?~uX5ANL 5愲½09ksK芈)S~]Yz.G:^[&/ŸN+lSFЍ񯇝1I8W=_k„o_(zGq/F-:(Ѕ,V--\v| #$xHQ8(6>Y):Լ"QL4TFyLZռ֣9.#1m\ ]BDc)ap췤ί5_Y7fv-vd͍te³8Mͭsxe4y=4zorOw5b &z2:w*|6WCW?M| q&3lg`G#29ã./ k3|ىk=I"L ,lu 29{ŏ޲C|yu: Sd,pA~Ջ~n]pPLA2{TE{ݾxHCJ@<$$J<={S1elw7s)4e&^ߍ߃x3m&D=.&:eB0D3ww~S5XP2[ZIͼ(D,6]aYD%8=BkM؀v "#*2!M@@Zz+#mti[J@JڭGT* p^ (=ԓ2ߛvǛl2!,XbD~><1K+]Z&kԬNĩS.a<-գǑA Mu֠ZJ0ONѽ!+znH?U'0rW'vJ~:AZIMN813OORx1鳌*fv=6Z]bye6ui6rz[&+Yu- 2(Q :m! M9kz}io՟(ZތR*'qcsq 7v L#إ ',S$Yw]wt쑟Ο:C˦2b5-ɠ HFZ 8RYWP[*#5^!ӸQh\ ue{~ع2eC_c`O†9ܤy m5v6ϒ"ULAd'z)92lZN`qVCM{b$Ve.GV2L'hvH \`SҰ1e{ܺ/@wnvPgnDZ%%zkZfFLbUB>L+&'H365I:|  *gNVS8gs%}t% OcA)| pTM'"?zFAr6.~7AHo9> F?$E\M(xF%ܜ1j8@K}+g~0mj^ПLy oDR =|ǘ饑i^HܺÕXɗ죓ȕ%93:rj s^rV ЅHF|6Pj1`t96xb*oS6ߞNDR}TN! UʻGXi3ii B9kh TgB0&քPVZFdFBnE^4JjTJ%g?!GX͔zGb9(C:H(j[QlvQwe-O$sN[ٜѱ4ӊKTP ; W:RVcCԛ: $-% B'v X=DސddQZ*j'_SAGG_\q~ 33ާjhێ~FFa 8T33 .i!%8*!tiݤDZI9i=K E^OT$dVsa]7#~Z}쀲 m:6s/# NճYxW 2#sNM$`a\<:"=QqvUbrJ6Rb5dذz F3J45=ta O<&ۿ3u(J+%1oZTu`)GԪhńntY쏛#pHAȂ0DxeߠrNFõ1πẜX*e6}ezVfNJ*^/`٨^^ ;e4?fgt;˂=N6S ~K&S15G1`e aL|EZ;> 8EMK2'/]؁}pl%u]9$ 9&^c0FT;zT5O{foWFNvґH>֠~<-iѝ+t}Xz7yc*18r#e+摼~gq!R~+ (utkݘcs]L1K5|}B~ ?Q]|FZed?Wޖ< (NR2W _. <~E] :$Ʈ#״'CðOjӘL>oEd Kwsk(\)cט4 ef,HH&%d /4?a  8ˇoFbQX!AN 5߾s@欐Lq߯ p |Ta~ %pwg ̕t&$lu+5m!.>z-%"֣Zg^VQO >C7#YsJ@x{!,=B`݉H2ђ1Ĕ~Y3e{ I:i7t53/xJH&A6tYcٯ[7_^srYR\y?m1< \ p:>5NW F"lAň!,<*/݃K&CO h{vnv"zBq_5~ydL RxA[AOI6V`3hK/aRɳ"PDtYd<{JKҕk6)A% >_kQp*h!&XEDN$a w0cmoΪnpSm$>bySct".Y*xv`&SB+z9fK+A<~gtyXt-B2!3.x}qmy\G$=v ݏ"'JC1E'}4C"V΅DqB];5ȠTLHΜףul|*%c]x5;buJs.R'H$­}e!y61PD񎀩{H&6ҢUAƟwB!^WE4Ӓn?;.6?9 '5_r&h `Y u k$9C!]As ̶ (FDp/U8O%_^bɆEH;E˶~ݖb-Y!cEl(#<uۊw(*g^g?*bZ/Pz-o$H@k0; c闳 }!Yخ I ulH>JUylnϏ{O3lh* !F\G>!zwrV{XF@cU{>|cb⎱1"QU(ڕ8j*@KȕDf-7YW>nd9 Ehf8ɊQ\ }YҬJegŲrx.ܸ7 o$Q݈§!.|u>H3 [~}a> KoB&g5'`8"- D8 n ٧i5d`}]7a]:>3_85| 8ϝɇL~Ès6󲳧} ?sARvU9Ft }z|/Z++P;n mpkN&42Ɗܒ|V $nm|E\Zt{껂% \!9Yp?& 56O oX.oOg,XiT]Hx-?Zně5:z3VQ nrH!gB==yvuEHRYfwVȰ4K{G}<s__ouqzO7`XN̖@sf9WWcx-;h'΋ Ym.@{ ngi<^0aAmTBJ-k~ otwnREt]5(_D,x y|h p];G k>(@gV8yϴMf'r-s[$$F: tǑˍ[2Jg` JNWXXxcs`͘@x\ cRp<P;")j=0'=!EP8_#z {*~#b'ss<*at Zmg 2fصӵ?(>6V|fAEZ'~daJO3Hin?ur 'kbR6Ʊ) ?aoARLRل/LQ IixTv/f//O9B/']Aus u+Cn?:z.tj[8=6KS3 &o~C>~'9g<߲>!/_AрfvJ~r[٭#VYƎ Zy6.vifbHx\Ќc8멑MԖ䬅*d ~s#QNb`KbžYtB-}/FmI_ =ş9xAj@8(<8P /+ &CYpc8sĭRVƒ:ͼ]Pz>&d %w\y=~˳s7o]Ei{5hH,S(v 1#.ob-Ov _H@]2/ g:?쭝|q$!D.=,QrnFgl7_;Oȹ-hP ؐ#F@]/.H 1n3G6AtRݫ-FU Q y7?-K0Mh̻"^i)wXB/#(9$~]c5*GhiYCŠcИuR;ds]D&f_|c;K1q<spq< =@-4)g=yjہ;DИ~:\B|DE0=3caO~X 7Qx.+2d+ UnBxU".jRU<$RSѡf@?Ӧ*3gY$,iĴyn}FLNISg5K%3=Q L#:X0ݹuQ9n:)Uz!CWֵ3Q ב]fG$vp]o˦++w#ԣ%-` JԦ;ր˴c3]{"]hn #ز6(XBAMU uؼ }'9*E>c'm=Iow0ãAdlXKkpD8 E2ؑL?&LruZ-dц0fB/~8:'# '@^q'͸㪢ޢё׃"fC3xP+-ҡ"CZEhD1,îch#Jn\#ņhv|gb@t0Kd˭f%+F&r F$Zf-J"QgPūw-s̞W[kN }C$f@q!E{q@D2=7|Ud_խP'(%)+`V>Vo!`˦2{,$)!"Og\05" G]HgE8MqSu~6\vb@p$i !xU Wo$tfOq}Td/]hssCj _i."oj32ŬAFt]րw_nWlm0۠.I= 6O1D6̵S5ќ="dU+*` I\imoTU]k YgFԾw#1IC .|h4!== hap}rcҪXOj51Fb B~(wJ?&76OG~hj($}:j- )0`sck55@R Q7^rRJNCVQ?IL΃/osWwnkcT~vKt U[KH9P2xD5Q8fڤO&W8C %!A~BzScR(vFZc. ƇC)V|3wjԛPa iI-cy0Js(ÎVm*VЛ%ƚ!J&BMת2A|P Itm(.o0mb,׋!,4M1nhsqR RS#UOv=&UV I!U'i)9!%l_+xFg]>0#8)_UkUg(a4jJ8#0( q%>>D鉴s$LH~ t=__d~=j[hDӄCբ<3#yPdcuci_>XuW#Q""2/u.V__LdU4d'3Xꙏ<[YF)&:D(i ADcr~ZyØc¬7|a #N ~S} 8]T3`;1>v"B͜G)I5笜- _@ЊWfiOEY`OR,ނ;\o.ſq]hZ A4VVip 3hJnjs5Z8P)mfKQ $.v6(:\xqM6ڂ)(z򖇎@E,yGlErŀQaF;R sWޖ[0׏z^I/2]pu ׍u5~@J$y#?woDŽXrBeBi];1 8tN NS"oQp:B&?2Oi ܉R&f8@.K*Fzc?3|recKՀ CWħ0xMkU2$@:0b)̖[;Ϳ {g<۬ 27fD H>~1,ElY ݡ:6R86Pט-=PCN]d@Kfq#wB]uf Z@&q  3[\1:voB؍A>t$Y(暾z`iͨq@܀3m:x׬&Q㆝/@q0>LmI?i&!:2O@}~e,f*&If-13\jKO 7pSJ 5ܥ%?t2:&5\ʌ%__2*$W;ttΟz*-0,9X2(a3h=3U%Έέ5$8q+J);ׅ'[*utu˽*zVWٹkzt HqbJA. % T2y+l.yRYdq&7!IWo(LIe|窹ƒZ$oy8( G}L"yE̲4N#0.֭BK#猝=OM^1F ͟`Vrs@Ma;>}ш39I7sͫ[l|a,E&Ri!I)!̹LSnG,V-te0.HW~h>y6/PJGyr/a'u J tX})bnGTj`=b֚mA![_呿j@Kth cHZm;_z٭_G_fd>8BS#,*9rczѻ5|\˱\W?5ʜ'P]jԏ)(P_{u&EIo[1~Lv֣2{Uɾ(|rj^"8{U{>Vcj/|/F7CMU#7-XGꠦYU? y7:ު9W#Dubs_AʨdXﲵs|eL~CBt$9!v1ҏ~{{ 8]qy1B0%;bVT~SbTGu5"RzrN!t>o}qi2 a!KLt)8%WlPrsF76mE W,PjI_O)U/2ΐq NfȜ\~e!Z.~Mvek^\OWƴ`8GK!UTZc+g/K_޹LJqm78IbB.m[w`<#Ǧƿ_3'nkm}Ҝc|m#ތ#c8dmvXQ@ v V44GܼB[wz#\)B=N]4ᩤN6I|ֺ3nz1ՊH{fo%qFA<ѼYG*,k9 wMw 9ZrHtC)C(AQ)oGKD6tda@8XF#ӎ:Cyqb~QBA0MYHI9 4Hp+ɕB1sc;h8&_W7X?eF9ا8+[d2hc=׬C0/.܎w|$PI>A 颛Zqz穎ivH7VRHHk,H,5PbZ#Cӌp%BFvM V\uom8Gw hde 5AT+ _=Y,JTsӨU Rn?&j= GQC?shr h%UmSHr6Wk W^56&>T>KIOYtp@}n"PMCz|n S5u0~dD3iSRYȠNw@a?~!#e-}GLNbexplr=v[m&\Y#񆴨ͼْl +fcB!lnzK!o—,Zs]nNrF,r]I+tc[p}RX CM:XR\d9+cf9q߁H67EXL}\Ũ|-Z*m6,ClfZ̎D+G&H*7R/q$vIs.3b稫>-m 6asy<g5m矹8@qͮ)\,kTt 5vXWaKhŧyuF*M mՑl;\%fĴLIf<$U OBU8i RMKwM(q'~ߣjp_. ͐G"uMP6|{/2{Fh!X+}쐮N1ͨ. 5M{B6Tu>Y`d@援dJvYD41ΰ|noӞ‰+ gNOs<~iUۜcn8xء9鎕B챨:(`A*uJY((CTAS))+ϓf7 Erѧ1Z_`pL;SIܡN;=H7J8MH6XO Ր~ܕsF?dL+MA4Yw?\ Qxiyj]+I GbTz`tݚQ4e }?t$dXc:֝?3ciqrGKOoE6Edz\n FƴE`T90?U72Փ3Z9{fl~ekRq ;@K`q*WH\tҝO /GVL'j󪞋8"cB4ϫj->/Ͼk  Ft] 'kwsi1Q)$ p&-@?`F֔"8Q 1Hxq)u e+gc(ހWbGc@@uS][IL-oJ]WYxgXm`bWt$ 'Gz%Tw SuۤY܃B2 RCĐTe+njn_軇WKZRlϏ⽕w;b)_|I&+=403}}k^ю Wo N XM"`L JF|d݇5K)]./R( H<0€ DdGRSw so|79nLl2nJ*2te1k<.T Es]2blot11*_e21-z@#j5eCٿ"v>$>1b(6~] r+7$~xh`*3Iw 'Dʁg-@/"[!c@r* ٷH^^[N6=LZ>p[5ƶLXMBzgϤ`Pv!9SeVݛagZ.~3&J*dVգS4?:%zB8uI4-~밷`HԀ Ϫz׌Z`wZ?Ɲt>zIcflh+ lO6|;&|y_U+rA4b+ğL'905'1vX'&-ξ XW bwuoF^mǭB9-oo3(b³~4 W|p3EKc:t=ʸ$ٗ.8aKNwIҜ\So#v@#R SW.xmi:FeoAL =YkAЫr&MrHHJM|S/1S5gtgyZl ~qR,ܤYϻnO A=t!+v^5rJM~in 鲜r*L*1Sv v9"jۏZB9M^…|nN0 |uNY?XBc|080W. o^LOiЅ+6Ki1>fc`^JB1}iȼYHE֮4q3›&DECO#I~ kө@$13'.zVfdk!$[j`1b(zм%CD`!Օ'(3k/~S_M- QLyq y _wa $L -b) G^1zuO""T><-ɹPI2;HSOǵKeœo*'ʹTE22Q z $0)tԝa;{ Q1dѮNǟY/o/tcI0Hq%ōas,qQ)VhpӸ;Qy؎kgËom.~(W~:nH` Ӽ@ h_=sOK[i%eY{^ ە(j>A!Zyp*l4'YauON6Uu@\S.6z`ݣRDc[rhLE %tuΣ0',V(rh@C IvBqL=Akέx.vwvv g'¹x#F.,Fuddɾzi SZn-[7E:S=Vb?N5KMTnr#LqR@ΑmEw{ieM~^ipuM=+xeozir*Y,8 Y/ĒI IxcҁlLuVxlώQ͉+{y ur9'hO/eBA&w3kmM.M>r@Rxfpi7B\[a4drV[Blx/[t-aoDs]VTCm5&k;(Uy ̦ ;:Kō./ZE5l^j;!\Wqg;DikE~P:?':'.:u;{-&1pYJ,RIl (;ÕyYÁ ~Ŏhg.PRSޯaDD+r3h3o]fBcGmU 9s2qBr8JI ,/amR[&5 0cloMO?6s%㣡XɑM#RXcXO:(FSh$7\*B1[5~|' :*7x+~R[ʦN^|I즚C%ͥd}ůkBn+3n+^i< /v\"2O7{{Cn.iBh"+RYt~[Jlr*"W*e!j<9 7gk:Bȃ`MC KgD-}gVB }g{uژbWUlP9㞿H ?Y) se WB%TQ^lXR{2~*[*V!#`dgeTP L;V)`&xѭA;7g򘭞,>7= סsjD )kɦad YSHRhEg^43AkRN0jݚ#%KC $ D=v":[qޚ%WDH*%*v5uْFM>ц@kиʺ 4^Fdv#=erv(5ܱYL˧@Y-pMdy*(p}o(9c:Mqf.I%uV0NEetBufKH)cxfV œ /X</ Sc?ֽ`x[{dreH*wV{!0_n0uyן#}܍N^z:gU9lx vqs5_N;"=h#m,PolfCRetMyvr #MIPI3 *PtV7;Oef>28jڳ+d6M~-'۶ a!W"iT]e {.b(;Lmn!Ŵscu/<;ngz}*:&hYލ_:*u &ӘmaB0m0ɔrX $4ۯ'rRPql]p'ek檙]3P IW"VV!EMaKV)tzMQpzim)?}l}nkvuoH됼qaƊĤTV^L'fJ ;ռ:~~UdG|8g᱆j2xC_ rm>Î &sg4Qq'OU$cR1Ի S+fXXj0_>'⇞YDOE\e Bz<5xHvqiK9_PzP*j`ɔ^cuu%gWLz?~!Š| :?B$>҄NEΏE#<}Zí+ï?}ż߯ʒg0d g/Aa7PI?aฐ@0Eܣ.#4L{e3G@4YS|/Gy"GW|Od_Obߵ[U]YUX jU>ݫoVzTHjNa!LGh?| ,Ȣg6-##ʦ.n o&Gnq|>;\m!I@o6 kz A4SNNVBl''Y\:$.$=š?w.n~ۨbi A mj9uwq2Յ(8n=d`!3S`CW4A7*O*ӑ8K]}ĸ+lH(r|落c̘9.H6Ypt!@_/T]qQivv>eyϭXI3;3n!lQ>Te8i.0Ψ<2>OI ~}x?(~ny$V[GO6 [e o4y;HsE"[u '@]Wt+IiߚDg{K@v1MHNxWO`K8ihL<*;ㅱQ%6zJ 췉|jhX;O~hU;E ം`$Э%n#:02^ oѾAH֡ݵ39'> H';.{nͮQ$0 #s4ބ] .G fa>ݫ7dx^x/:[71$wJ֜IQ? F vFW{,*p!\!}>@}e@U[9?H U~ ^/%# T@ę}sJ@,3)|r/=ňf0c'6zC|pR՚C̎(!b[LY5;d%f"N"z'q7z!S2n-2.K7*X r?KYK-Ry#}|%0e8 OBirU B M 7%s]u=aPɗ_q 󐋬QF=8 :f*ð_E!K iIKC,(};YX ,Z\! pEŶ.a顋^7$gwa_B@A-\/3J,w~ iHi(ztl/ɦT.=xY^[.,hWW`dq7Xڸ(ʮ_!UY_=QO#̼JsC a܉=M"vOaj~ǒ29\:Q".rRNZO45O( ج7k]wx%pǣc1N03n#؝oQzri˵E]I*+q 㒇NAiWTM@,*\njwzmqRjJy(O'OeX41o-K }t=ORTgE- Et/ {j7F2})BWjAZX@{nGw>9mHB~4z jy=*Fw90@lv"]_sjjCG`d u2%6Ql D#՚RtyϺKc$;D9wGI: P-MA0`pW(JOaL`W!z;- j*$DhL?x,rlhݚψ֝M[$o3j|+kħԩ38(0}FXx\06n7Cq_#.bԌlEܒ3pp{L"B)YP}P}n#l~B"t!_0eֳG= }͘SL/XhpؐMd8̥z6kXViK,;Q4b:РGmv_Q䇬8Z1ϭۅ:!|(GZtaϫ/=H)vlEIO#h24v'/nO ;O<7&9:Dޞ+r~Cj0ez#6/W]D.ƙ~_ʄ1&ER N]:fBqem; +ǒj?q\ohr$)4t{rHl.4j8 MX=2!{sCo@]$@SMˆj+dʟCKHLU_1u}VNIFI2zהNÓUf| n|Dq srJs@p5^ez27ŢbG$t]'ӖJ! N-ہAڼcTTL)NH76^~9h}ԛmMXbzn{[C)=(l=lxXO.ڿETx2~G*H<x+sd͞@eg]Qv !y1a1C‘@ >M PL$)4T\~5 E (帥ʪ{4G5͗3!:,3vp*^B ϫŐHGGmxAǿ'ܡH-&j_SEO5.*$8}~7P]6 l]݈>E1s'w d(nI9j9X=E *hf1D{*׈ުbX/iR1\>,Pm1JTcKvL&9<6 jF2TY9lO྄zzG2: s]Az"D+n崀N`wiK Q@{Bt<@Dg$>]<8rRI˴9V츺n< uQ&%M p|>UtMƒʓwDF:R#k7@:Ty0AL"Mw^vS+~  آEN ␯T_7 ~b2H=a!kv$@K41-I ٖt(>kza<>%[M]r`ys>uEo:L4y| Y$8b"_!}Dgv ~QRw.8ok|yOwx$=Xm,3tW)BWXSGux#|(0qAbӐWHj/?q ir]iܿS:&Vpg dmB"r~WDfe/SR=IZ/JJx3Wh KӐ9adUyͿ&9q Θ̦;g&9tG!=A}PANCFk )eMY0yc?f$?:Z={ek4&)`y K} 9N}OsԋRptb?sΤ[ .73Z xY!8'SbAplSOU[˺b6{Y-,g?^z2i5/ڍiL\ςy{޼O4,1.VF1Tt}& 42Y-^,#bı6%w [@8. 4k/=fWIY"je_ Czcba~,ڧj\F&(%6f̴U]}=ZVy5z fe=zEcy^GY\,رrgCèJ@+cE:I$@ Yeu9AA[b Rq=C2& l{ .Q9+<dVE 2H`?x(XB~,z?6w[&>pnО%1g7K|Gq1z#:oȵB>BxY2 %S/8yP*^M[N\N!wMfϕ ̻Ъmᰈ:>i:ik-{+ЛY(\9_+4Qz5af M!NEDWQ;M[©3n` wȯq޺Kd_~o\w1O`DM2#y9hej6lgO+$C ɟ,܊oA*Nu慎 ciof;eLjHp#;LnwfvBh/2Bm'jW^P#j(qg\Zd]Yɖ w=? eeq-[c\d[Et5iN=AҰ8?hv!PH^gxR zRw(\2.3DZ`Tf͏9[qbBҽ}{Yr_rd+f FT ְeafEhɍ jrQ^A TE^Q U/M";L|e9HAY-lAZٞ.>@Z:& 41Eu$ N"ya:;a㉥1UatWͩ Jk9J.D`Qߣ`/*А< jV $p~%QfkrCؿC0`[:P)ijAu<9Tx(p3ďAY U ԟrzU]n8~𽯨ްv\i[+|Qʼ=3y ٥>"!TSu ݯ|Y$ ZT,AҕDf;-a 904o0W,|7qԽ'35i2hI))]`m;HX./UKJkzcZ=^NnbLLQ4"!IGE^WYQݭۙňR4#>B6*@E=4 6_nJY.p'.8jAy_%jDbu;QF{!ti\y->J`TѥI<^<"Q3@ĉb"thfk{Iz=%ED<  ,f/:ܴEF&g}cBV'Ǩr @6?iKޫ+F[9N=ѧhK"u;#  G=d 9bo uVO!0d0?_(d&M=l8KVt.X:EKBhsIteJ*nv6> $=QNM+8=y{U}~ƛ\n L`&tBȘtpgT̀ӱT?rWӢD,y=\M d|ik1&۝jo9$-z@%2J;;y?d؋-b^W:,3]ǁ#U &CḗN?=N?oOҵMeNǦO^( ~|^Y(_At; g1иeNsՙR HG_re-Q6ͿzM%`@ݵZzGϩa7J1<'^\(8J?@W|rWL/Ã<=uκD"f%TύwJeƆ)k`UNVH ̡ӵ~:#"_K=W03;ϡs{4m%C]:0.P5e01y~J2 mBZ26fddm%jhvSLםˬ]I@?o1y1(kWFC?61Ǐd< '|*E]:N7Q(`Gx`'g'Ghh16k2rRIΈprۭu,G7YΒep 6Dg+,ڄF17p헪ku VW@^GWg#qx]XM^Y[m+Aޒ+m,a%5n|tyJqfX憊+WwkbPgC*Oy FH##T6Y5ܴ-fOM*i@ G9`{:{Z| Jrݡo\ƥ6,~vkO[p IGS/L‡^ъ*#?CM$΀q֜ҳOV~G%TX&?v oKV7K !bR ,50&@C4wsѶ#b.ĉ]t]„e\6|+ckIiIhof1 F~*h0*$=,iHqzd> '֌FE~c4Yl1Oi`о1&8," >ecjZ{'T%g=) eeoR,y%w!hɩܰ+j`լn3^4au]C6i|dZkkYGr+ _=U؛#$lV͔q "{lU \Q :YL SO4w=wҺ( `} %֗mYݷ+JLн{Y8in/b2!dgR1֙HXxOH3/E{J&)Uةi^r;l$㵺cf6 ؊̈|=ONK7ڹّ8UNrIޜy[f8ݪ 5hpIf=C)/lCcd~ +f$k\ ^{Spd<#k7Z9[)㖷\04^k!3"FaHw'E .(?BW DDaA_Ӌ$G_}'@IfOmhcPx4߳-Ğ2kܡZ7^[m#y?^ĽG--φu htJ:fWR%`5E_큷_ GPڽ,GDU@DǸ&]xrfR;=T|CR+,ι,d0A]R&ǫ ŵ'+7hQztН:Cښ!,d¢OguMF$xh8w=4< ac,,v]8U,,%ښ̺E,Q;}Vם_ILa\Bsz3# ~ &ȯDݶͪq yUTՅb,}Z@( )6;M!H9o =V"X۠"G,w>ڶY.# ԕBp[j.Ca4J ?xnXUj^s #-M.@&Wݰ'd!a5/uQQCn?9Z [wB ]&`*Ta{c}cO8Hf7qC^Pc6 0gbxJ,<c]I^aJ !v0G[`hsQ`_ 9q$}?6 ' nIܬ)N?[1O8|_w@[ړPNE9SZ- `tނwX}.i(m\XШU䳦z}8.y\ B5|RYMeͧ AU1CSmU‹ض?*kEw%F[E;D1y+Cmޔ i 1%\:wDj1-2xUʪp bi9d`;22ΘT, ZFxuƣB'-~%YvAkhVi;I._ڑcc-La3 r)T]3)N8=Rn,_7kkU4SRcIv'iJC [i򔖸UD=JcMC۱&8%Uށ|doQaW۪TMYrSB̮sIZ ϯ,"`fwۗ/ joLe8h\ӃJۇNܱONwȊEƈ+10Q6E'#;\~d}5PxJ`Ȭ3_Ow6?NJl j>cǽ.i\5aZuU֑yʷ*N5hX}8mwic#{8漦q;ܶ;şfX73n('m✳AZ$Y4?Gي&[|WӴәx]N# KeI I _ ENuU-|wutU_KxU;+ؔDh{Ѕ\%vhu:Dyyr7ctC)Ώ0&x=J_hMhO\FFw`T{;k>-_ 'MS6}4h`BL oqZ`UjN%SznUJ8utX`6WrvGt/io8IF$p[6gL'xD0nӓTDʐo w/LJ~2p{5ђz㨋: :Nac y֚+lf 4dB`ˑ;tQX#m Rh"ra;Aպƍ9Ơ6U Jl9(ؔz \R&{C$p[Wnm=BY/ZcJ]Zŵ C3g, 8RF˖r5?ޡlN)rzq#k!Y @rѲe:u_QT uфh7T}AY/gJLVn=3U m\/d&9ƲK7oS wmgaO J#ڷX.a=ྫྷ*`x:?hv ʓ+ hi0`+ON㒲tp{㒦WVQKmtίRJ]!UHN@[F~6/P#@=듭$%P3M*#Kf!F< KK=Ӓ(V=wO:t>,ޣW626(MQv{ :D`7iC1??zcdi)ݽ3uäYC)Uh83mgQ3؍ _L}¥*qY" 8ZTpG`'\ 7<d5YǢR_#{OP@_|8._w 4}eIZA]smYO}k5xҜ^PbUձO*O~R;t fUo8Xl(?v/4輤!OkyWK|c?CivhFCMa-nR.+?竕o10s֝s -p`}Ҫ$RL=-xȞ?ŗDž n=2cCTn~>TVG'YJE3 N[-Wַ&|컐1RNe .qYo@un  nSQ^΀}Qp\n29X5űA5!_%Px0>}\>6AjGTmjJ7r?(yݑp4qFlIseB_mcVVFkd ) \j~5d9 KE0G(_ ,Xzgpߦ~I:nf%!Y??RzL9R,#V_ B@&&@"WWTW;˜knԅ,{_.C̢S+Ԍ6E7ΗԙH 5?nC/iRe##9fO!/~Ux ϶RΝ4cR٬+ fizaVq{իRBeFO9Xyė?T`6$!I~E"O} 9nQODWB/\܊ :M/Ն*GJ~44q_+ PvI_C"chvRJuiO Kr8\>GGOãh- W6I9[i~O Ǥqq{?X>+Wy44BU6tF+H xWaBJ=6z(5 +Ir=KV>іL^!P-jF-^-| /D8-$gE#bA¬ewПװGJU7>ͺXQ>o)Fث<ۧ:7uugOcZytȜqCU&oZgr~F\I/NN(}[q -w4ah@?tVFfh)}P^Z0{f"z3S4Ʋ9a/7ol{c0[mMv QEM9H;V% l1hNJ#Yvu4b3lm&_QArx&:5P`.xaV\.> %=s3K]?ZФh颖\8 `g'#3|oG ݍG7eG y ڡ+ IGV גE9GqXȱ#@pZ^I)\pO}n':c%S|^~Me]8`UR஼))$ƒi 3@? 01/[O ж(`);,/RAYTȷtOIaǵq#L{ɎR1'(q%Z/\㭓YH|.'ŢAp?mnH@mx Yx_21:8 cK/v2M(./I- )wD8Y& MRHqE[34Uf_\&-eC zտ٢1FF͆AsC9 $>Kl-NV:{F!&ބ;ίa S* zVqfМWɃl)T"&6WΊCXABRLL)5Q8g{O4F/ &-[+^ ].Րb;a&grÖRh@?@\qm+4{ vVxț54(5.*o )s#l%y@7LCWV8+JERY" +%>f<-:~묳d^nʞ= (a#rL2qo}: aÝc4|ghӎ)~ 3RQY~Z։ʀfz!>-laoÆP~y!+S9kYb}w i@ 2,L~.iOuRyGBkIxaq(@3C!Aө+1 jB%-$Ú{h%>2؏}4NXpv3) c!r,Y:e\jM]YG -Mxa)}xdхWhsd3\72+=y䬝@l<%$Xxhm2#⤗!}c 8mY~(j{%Y}ܩ ZbKRZ0ŎDŝ><ݞyh]ɴal 4~QKTO0߹s2IIπsDʵKSjX@`FyBGJ5)SamvĻ\Y}Ƽr>A@˔ԇtr}c-.bz` @X606B5XRwU%{_ "3o}(5?QVd yzWaY5lՃQaM޾EVgIY/wv}eS"RfVlX@Huqߚ9B\b2aw\6IK9مSYf^hnKZ ~wU+5AU?Uٰ3l* YR8svTS>>;{ƛC 嫍Y'5alj.h^(+Q&qLI!es0C&8tܐO&xOo FRn!A$zp;OMW-Z?Pbb=n/wd(?V&85`(楲2pǨ53|Jnw(E6%a0K*x^ϩ>*GRSߦt bTtM <)iRqpz[LdBb>Fp!r+?BR*°8pnuF#@7} eP7v`LqN[YORr,n(3!v7r!7Gmr t]h`1VnQ- fXN3wX1B.U1Yt cRM ֧$y">uC\kjHb:{ ]P>:FF??-f+N]b~ޣmhѼ0rkyě|5GKT17I~rXvP\pZdl] a{RypDW iuwgk50@ve g^>57K5U6n*7 dq}VV,/Xxɲr& |.alqKr[ʿ]UO;z5܋Wj[/DPPK3){zGuUwm '9"bh65/li&y>ac$fyBؗe᳥2"E.P,}qCn6yuQI ln7Bxv 1|x--C KX_%LFn!ly\n2 ~yeS 15~1U<}Cʚ[?hM 9"jy*vB,;]0D9{!"}n^q(iUJ%QIgI7t4: Ihz{/nAo(8ox&h:$W\ALA!-ʵy,Xݛ7w=$׾-wU_݆d2/aOҗ @>.87 4Sk#^ A: K6p0YIlc,nL ?gs}ϴԖ)yKP(ŋjTd/9w7xp'=oͭ<4~&I8*ె|qbC"0I5[4 OgǞb3wve܊.7ɣ[N!#̱2>v{,oWϯq5=j.d4hZ 7AHe^" vbUI=2Of̗&Q*Gt$|gIϪdܖF8v!#aVOxU Q%r`2^i>F7ZDYiXiFN6əc)Ψ?r 7*:zQT?ojT̛}dx(, XxPܧ#@v٧Si<svzaSlk¯Bmou-\^JHzr;%R%$0$m'-o1itpC>.)fA֖Hۭ#<7ThBmt\~9wY|DRz$hnN'/Rsș82o+-ܼ^[,ԼMi wߏL`kz<(ѰA3'_ea-) H#<:[[ۼ1ݾ[bX[|N[]_a4JC=T8R 12OEۛe2ҒV_XO"Ɇ@{ФSe QFk[7i6!SOba3P7׳̴쒴> 6?D`x9Uu6GjE"(\kOya/Ք-.ɇwY>oA.ɹtkRFSb;mq)-mg2P`@" .C9.Td(zo~msQb+y fVQrެ(x.Nk\ߔ3 I8RlצΦ@xd?bd TY U> ?ĘF/;*I-V#iOn[r #A#:9N.?o遨P#PVVqP-~kW_]~*9s;HcKfhl|A`wsU_Q~}z$ FxJ & }S}JjrpԶ8"xw.Dzan??>p&7j $ୋlh* w y#In_HDh6=]Dx.m;s n W߲Tp5~xvWYqwz)bBy>jB b`r,/I6]nq^֤nroQ(Rz}b_ f&+ځ炩܃PzDύ[;ә3Cpn`F6Օp;IfPD탫!Hr$Ja7F\hM,[0 l3y# $*Of"W0c\assGXC%tІCs߲ݔ 6i=7Rz֝4+nH0pI&>_pЩ>/oTЙj{01a*[O= mՅ.^'Oc80!ubR{pf1V8K,f@'wg b4@4HPWoT|qrE+ nW(DXrkurU 0-WSB~ ݲ ど^X/n#fTv = 2ҕ~+K7 C>JAN^)?0z{u: *s޺ ڌsvp2߮tMĿ-3V' =r򬿹- 1vAGjpLU͘V7>*y*~NjJ1<:3o _PBPC}EjPe,PS噘?}%M}#}ϭQ9v{@Dv:[l|"5Y]˃Cafvqdҕ9%G!P1B\m ] ƠQ~6|}1h]qD;zp|hbrKXși`}i3xΔ|wB/^$7P$R[(& (3uJỸMy~"+OOtԞ,~_YeýSp?ɜb 5#DLzաY~a_g1 O6QH%vZw4cA ,#[\gyeہ{<ӨW:iO/ʏ NXd1S7;vע8$Te,-Lf?(5be7הdX6K 5D.20jeƣTu\U@A|yrg-bs,1Ql?HDwv,e` :K5q}Pu?ٳLu:] ;w2(i0ivR:`%w(+3wH'܎'z?ńm|v+ {\$ՄdA\0Bp}խ @$LqѝXdжFxh\ k0(DEoT 0h?~G> Y`|WklJYr#=@z{(O&ZYY)ۓv&S}ܡJƮ]I*Af857qL/(Jx Y4ﱛ骹$zk$_`~0]y wnζ_.r7Kbh !wR0ï2VgO_^%f~'L|"tgڃ]k2: ^eG>C,`=*I.L:*4]z=ý x2c6OpqV^U|dLJ$Nh5l KzE ˠ؊I:[(OԄhQ RL13}hϛL=~ W%"R Be8~ܬ .DHNZe_}?^CVT=J-| =鏙k:NU; )NQ N}q".54HҬ>kmtkkFYz?.hmuҺ>EBW`pLt:ò%nzwQ Z3QM2 cObŤSTޛ&a%q6~ [7<^8O,!X.[=Qv;+NT|_.g1 Kԉ5I`xu3%F7^lU&W;9ʧf']ӷvU tż`= ]AksӺVVF4Ջ۰Gip$#,[8RF:>쪕)(3a=%Oń E+{XS)P4D"r[P&Qd0|+Ciaa*a4|wY':᫑ &Œis'/3tj,'O1ƋǘپYhp?i% YXqB!%u_Iдs;^Y'+~)>iI=ΙF*$ !|!E}POuR2&aXlAf4=isAh%o&ptM`dlM&(Z1?'Qۅ/C=^.[dx~},n Ѷc!',G0' {mdEyۚ@˅y=;V@0AE }4ECxNu&3DX7d޽#C+ߏYW2KqlyX?F촚_.'Qb:ı z-&6 MMw-hH\ Ї%QP3f&EGŘ;QxC2y,fVJxo11ND4*';8D5LYf3! (z 59$gV^,Mŗ\݄$"*adPfPlTrVXCT\k?>_I:g(onkCZ^xO#&y.Mofl*? 'F3l>sSRm +n;8˹qhhWg33VnBNn ZeRxBnk!pWu2<~Wø7a}p$ux`[)\3Qiv&f+ )Y[ 0o릚WO9|tr:j${_fr WHIR|Ia^ˬ$' } }|(o ʺ&X } ,7k^zf<|aW-pbUGfda(<:aI1*<<24I~mM=u4 V3p&ygM/V[wgTdd Uk}('Sh|KoG|)yAk%GB5(p'o'yr?|z y{[r^u4hH}{y߆16|Tb>]Wm`F:C~>:5{| `kmMyW 0Qc߈2%L~[IRO>/e='+ncjŜ7G #K\M "ڥT!4&dI+fEX?t6r<7atV%s~_`=uٴ"c\W0;ck%AR̃[jE`o ~,RFɩ 9id [Aaq^%9<PVcJ 18Xk@ 0(%PRV*+ttQEK!Z:aŷ6PmpWa8[p _7M"+tTϊbvpͱ\Qűhfs< R| 1hnCT\^]pXjn5hHm󠋒ߌoo3;:ݩ%<5lĂ!dA.i'\5l)8::*siur0 v&yXHcT8(%@rM/FK]2GV7֝O'/ W$7Ѯ@A+zԽ rFĬ}ć#>< %@N軌.Aaq,`MbpzB̙-2̳P?u<G&^⏆.~ڴs(t#Olj?[ĿћG'鏧gE,Y4/\YE^;̷Z(7sԧN?-Dr0ũʕ?HKp{I2f'~x&7 2%L_檑T#ewm!ݯ7oLh 8 I$F­/W-B]v ΆԢT);fY,j/~hm44˓qdbKj6^܀}GouJ+V {N6J*/71klޒ+3ISҪe0Ty/N,hQ} #,˓0$|cnG*o3i^r{۫pid7)g^D;k71xEb5Uaj$U̻*["L?w- -p&M0RB}O^wޖ~(1#g jVk ~ai *.pۏ3 u.D yUfx7>Ϗqk.]@%pl*F,_R6Tq҃Y"أk} he^B$2b:cIWaL~0ŭTKe Z28ZZmIg S%T4%EKsK/XjkdfM!ރ U嬁 WQ!<)Lעb@0snv_Fz`uB@3VoI9=Y#p`RbUŐJЈ1BR}QV>o*=0 CbDLlֆ[[lUӧ.(ˀaP&Aŧg‘hC0ŘHN:`%nn|:e611O쯻XL| ,|ϬP>2W,dtW,@jd1/YP^Xzv!溾~{w=Xfp.2wTľ(8&!E{B("rN$t99p@ /tnhd Z0h(yH&<KnѴkeĂiyPG7Qҁ)V.AiReݙUZoDm_VnEt'C 3wbu3W9 "'+Xf-:#% R5H.6f1gc"vN@J[1`@r/I>)H歋hjMj"c-HBBV30L9/ B U>>Vn0%"5jؤYIqԵqiNpvsED$x}uf}Xt_%[NܩV?_WVM?!K#3IgHcWCl_롳!lkn]owk-ATTS˝}&suU>DQ>{{Y [=തJz2~}qe R>8+/3(aC`㋜((}'cQ+j+NlynPcسyc As$;YMGMfMt=-ZUyo9FGxrS+9%G8X-Y^&C ZR 'ӰyOӭ-*E[,Ł QV72ե6^NA- [E@զ%}ߛ:#p藧7:8|dJ4|{tPr#tgTݎM7T< 7 ^q]yHޮ⤑y6d;sg ;Bh *c`=GM}\IES/PK Asi3xƉg#mS_hߖЛL$~ݧu)jжp-1a*ks̴|JPD]vF(|Kt0 Ȭ3\*MP"A袂'U]'{e*e0MmFGPI&h)"|A$k7 ?(nYP@co6iuV%ON5d|QQF5+bsl\յqoX 1w奚t>߹̆].W2E$à.KԒk&KmqzJL#4G/k@\}&4xݺ noEqEFC~۬^^r7bc~ 4 &M7L{+C]hM9J]i0ʾ=YρQ {Tݰ< rXG5,L[pOD`fˣOONXmg;Pcy CdT#JZI.pl(%x ,ԁee0^XnkpeSEm/ȍzȑ;u+c^sV#Xxs7!ԶxGڨgHԤB ;U]پ%}b*23ѻڝ'\A~cH-POUٓ,0D|rrfVTӾ4a%1q Fll˟%=uYc"#-DMfr%U$?V|avU0ُW-uBx33M+Fs;]'@!kni8!(AGe뼃ۗHd{tZfY0Mm6vI |l a/CCs'pQ9U36n!&I~+"仕zJvtGZPbMU<2 l/> Q9-LI4$05m],҆ J_?^NֿPRi#4:. BuFHgr"ΪI|i/?Z {*<щgzM{@P8jC-wt%!NN?2Jv\2:&<$qz? uԘa! (@vG^NXq{)'m^“;&W _:n:9UHiSxkh԰@ 8::Il9x{FPe3^̇uƻ x̍l)9m۴h0xZm6X6օ &P  Y2uZ4/#rO()3!{ffgiİ [-kB}-ӓaƟWME(`m`&t`wю; wc.j{XY)w1`_iEeǰhhl?`4ʃa}CCYOHX@2|yPL'`愌F`ڝj7mĝM<\~aJgR_=?VH)7N&q[<0t2r`l DMgL&Yz"rg: O_Ͷ,-H5Q5){5`"ثL_Ʇhet\΍$hԝu[ jX¥S0߬@21 -ޣg: _rs568BLIT'~xemSَr|Qsa6={`&ȿwQNuH|ϺZP#?{g>qB4RЧH?4ߗ:}SY1*yޘ&Em7ׂ A6@N6M7xW)U BҽK#px}oVxJ?Z Gff%0R) &~6 192i OE8`Ԕ&X'\vKK>9?CI+ - )~ɺx$hC٧M\9FNf|g+(i]V0eST^ MWWWC$6j[@өqqHK5T& 5_A 8S!CA`$l5qERՉ^g엣_05e N4N3ѣOοyv / oS% GB'o?Ip=x6Q+w x^`QrZ5M;NMSG2zE9:{ƪZ|2%%;)742RMya6 2`%S Bh' F-GrҩzQ9noȏraidnc2M.AMn>`,9Kdqγm-lT`Ĭ9ھȳywbJJ ewTPגRLzJjtŻ )n6rxdbzX \sd傹:PQnXKZ1!qyfjBHhBuՖ -$&;WV$!Gg=SqSڸvi:i7J~zJfTme q. 3?3-s;`KT,]ł9Nc\.eO7P]wu~e>*3 ƚ2cs! 8-)(*f oID?FϽLU Fx|zSs-AC{֖CKd1Ή'2-h%,İ8'"|H &MD6 P3b2 nZtuenk|Y0[L&@(7fib.,jP%T8XZAHIc X)uDILAY֩LdBr3!5jC_ؚd;ǡƮU\ ݖkMAq5Eb4g5Zb≆Tm΃`ʣ\ᬬ KCZ5#Xڦ5"XQ$UQH!K4t=TԊU7 m8cdJZkU wyMg8(˗~cE4bķbҦ!9UPթUr0xDf6 0 |%0*_LRң[^є|X:r(&!ہсwX1DuLs;UT%dQRg[r63LXS#n}@mq^h)B֝{&<{Xr9GY T>"KiU TKeQKEmJ՛ڗEKbr P,c3LRY;0 @)*E֭,:&yS3WUhJ S{$Zm`aDqzM! PHgVtb`<7Am,CvTIɅ yAX]d r]|1_^EfrbB} YlWoTl\OIWE![ ~kCYFc5KCZ3d*䶴.D.{ !+>WX<̯))O=0,ˆSkaGUv3E_XYvySV恋}UQ6aqVDL ՎZHō7V"34{(S5C CT2ZɜE=#R:b i;5q%!-%į(PB}^8P*(`w+sºm|ѹa߫r$\AFvø GYғbRH '_zI8[oi?l~BvΙra 0 j@;o 0^>&0X9-4dqA!3ړSfřgk solpo元~ ^̽F?Ѽ"!/`B/ys>HLQ ^V>a^ +1ejKKޓFQ)D `!64ԭD64ZJR ;͟1NC9*'eG OD&_}"ai Y6_6X[d}R))g]wP}]nq?Nb A BTf4$՜ؓ |䵤qVV#d '͆ASVpAhb(^qK8}g˨Hzjw-,0m: KwGӄ1'qt"5>6ݱJL۱S+oeit y-\>spTeX}i%i|(p>ƸÓLgK9Q^V%+N=y=3 >^)>5iě SO],<ЅN:RoIg)ZA ~:y$zMjGJ yy5ʱØw̫Wb&K,[!G.jԚmZdCyq.z1w'Woi{^oIzZ֟U#?_/8sBd*-Yqy}<_#Oa4Ӗ)5(LrstU. K}ScRV6\hVۦFg܅\[Ysyg([Y x@`C3;D1@=f!s}ml\ڌxX\ 6 ^M9>AfT}]{m$ ˰V/,ס ls}]&Wx=]2$gYoZ&\Aqkփo9:7: .̕]ry8e;,3`s =Fkrt1ex5ί5جvУJDE|{zYr[(g lo> a,>Miw/^mVNk !/ D|E3k\LgLaMZlbxz U: jQV6\4$&!40PӁ^:EoI fbBXM $Z@ M&k\7@W7#z $S7IDoV'Vڨۂj8z#*^HZ uim6i+E$(hg "<[C}QH\'ŎrWJFRށafŭ 0\>H KƻӺ2Liwv9e11*j dz?+MrjaD2%:/w-\M4FuB-Ҽ!/hZRBsf˝&)L [ ,a Edc_NކMf$_T"J.;ɤr,bDOkb J% ]UZ(?ږ_1n&l[} ڊbN0V:IF/F h2qq4)ST&jLzꂅPq1R(k5hA@o+^VjA)q gqfWA4vV.9h"RVya8nƵt[vP!dnyξs>*i7LhӒP߁:RG}w~jb;9=3N̈C+~&\蚑B!9;Y;#aW.8ȫr1ِ:L6-kq{?vsn,,> /t`eCd  I԰sWW9%͍i[ 6b6 S &ƃ!8O7M\"ʥō$;62۵|CSD0d]9Ity(@2_@[Ĕ@ ll0X#pf2[3P(0R aÎ/.hr9i,:!u!`VFa@qX[idڪL `62Vr@QdN*W#'1DIsRr[)M4x'H+qNf `OڐaJIh@쯺6rRomW´ٕ\mw,.bz_QG|`vrL`'YX3tVg%6K EW㥹4"c> )] R B;2B LrHr%^~@`V0FHGq{L0) FHA=RwXD)m1i91ۥC!= hZ $1FYlK=ta0v-֜1ʹqv03r 2ٟ8tZ 5 g0b0(k}T:ٴ ʿR^+Z%9'V 1ց΍ҵbi9e g]oz[g z:cUkxKAs Y.eqɊ| d fV azpMs-2ӗP>~$Xh&X1XuΘѺ^腋z#KԩJkfwɅ4O .A`6MJĆWu*C SffZCi$)b~p$5e:,Q#quتAW(d9 g&-и8Lj%KzGM$~}ENm/;~=J MazF&MsWuM݇Env`ҽJ_' ii}ihLɍT٤;T\hBCfٕ0ly.!4:BQCרNC)M&s/%(QJŸR<~U&!ECڱn(ZUGX#0ߟv=Z(coO:?ϴ u–ξ=--\ym3rqgzʬcIJGӊ{5{^`уm{7lcȢJǀذje|\j-*t'^ Ƹ#)Ó ܮK5نE"Bӥ!Swn7 fmNRc6:;oqIv"N?ԟҴZd5?\v6_cyM߭w/ٳ*nKL>=̭5(lVI,'O-R$gsGFA:åB1&_#łxcbv 5t_Ƹ?:6]w*~RO_5^pԫ+h ' = 0g禮4µ<")E*-'`W(4/%"u5%E8aszMт7| pwxwvlQk"2#)t&;w2PHNyb@!kprXΟNT7 0"["i4%lؾ"EI=pl=Z(GS::G9@jI̻{dzf1%kҸ+Q`r::zA)pvh5` ArYԨDtˈPMs=%^ +à ֵ,Oq9C;qhˆCC;TjkH-\W鹿]j̘NXwF ՖnքOLT*ByѼC?'zvdf9+yBzk4okMv %:E=<_˵JBN"Z5ky^:Br\Qh6(= cA;b"*m*Vr0{\Y+,c1fKo[-o$E$6ӆpJMl= C'v{E&|}U'y'μVictH)~[EɒmHeaE1^2}QB/pP7(9#n)GBumzc*![BJ;@xM̦q/`=ƫnMbOqM'pont%ӹ?==|HfT/]2s G{3r,@:vm/2]P"Se5hE{+1亃B%{! &LAKM9\twFQ!0BXq8gǺSKFM=~a rdB♽zfyDѦp0TzBcAni񬀩yr~/s"c|2Fw䦙kƶ`gS7M;%p&w&]Udkz?$avJ+~qՍEp<B` +sy$hwXd,so# ;49cG]Me %ҏ(ܫ񺴠k58\ EyHDR)Q԰?cмAݓ ,#xU5.?Ś{Pa~U J bcxˏBw /WhPw!< wx~L6 xF0ZlYQͽvJ%NH0:xP`BEy[Qăs*r6IUs.8OAvYM0H0F|/! P\ƛ HI?정 1Juͦ)MC7 =v~hc:=bmawv[F;Bd` ֲA&kfʥ϶ҏI_hyt?_n܍5-)krGԿ,@mtfMM ]}* voi.mUt?fJTڗA8DȆlwg5E/>87UhhюnA?:O|K py8\hsh" 23K̾˦Nrh`t%~;bHӴ"ױUN)A5sr f TgcޞέeTdEK@6V\uX(L͚EF;i,]nS2ra%_MYmz?Ҿ:z[J& qXuX5Ru=1!s=KS4VȠw{6A9YC@R֛,YnJRySdfjdW/ "HH !R22BSTma. (I"(H*!"*HBHHhc:1ߨ|8Du!mX5Xq>]3B-4?T=G_ӟWOEnd 8x8u(x fg_=rC4s4}n}XH='G"L3O3rIs~\ bx.UccPvJfZ兯[3gxyTV4y|Hu^~&Q/qAk^Oi5_.OK̏-Xn+nKswt胆sOu5k2Hc2ISؘV%\,]) ]p&2PH]e\|ſC ѥz_gN^5^ gOfk2{.iZlک|۔jgnG^FT0r>ɸ$yNܯa~Z/.u=y`fxGUe?<LRe)4!X}y.~y7{-R1gIֿc1AiU@/rffaNFi}gG{Բ1A`9k=nR)>4QLύ#e?!lhuZ3>AwԛwD]E;~%>|%3 ݳ.V,q#`^7zWCm3}/ݺWq_\(fbjQ3)NU 7 /Q?/y& p 6P3ܒAW*G<4T JoqΎ ;@`#"r~>;fsɡɆIob7C^J&Ov>ݎW5^OQ.ٛ~ImhΌsϷ'} |{mCfgJOxލg mv <ܗd+[/Bg]>^]Guq׬uHUO8M'nOlk4<N==3'g9s1#̥wޗ#9|Zw^^nibi6k :]]Ds"??tBo/Nj*YC3k.g?G./mn0e3p*S=8Xzf>HpOR{)n;{wZQPg|SD-[{jLkm|SnQuՊ%djGȁIڋz܅Hq?}!7~?MCp>h]9}pQ'EH.0;#B0Z:˕qM}oV1$gyqĕ ~'M;迺B0iyoq;?w0 n/56qbu[} @eIf1kxk=F_wpK Nf ʊKK5Zq87:26eL2XC鵚7)cWP 2p.fFv`տޙbI0gf݌<k'w[Jբ׶3 2$).+ɓo-)W%e%{&zFVMuDXZ8B XTC@uj.ݺNJ cI Kk6'?DOd3a[JYudWGHp :P6'Eg b6@' KtFi"[qDT3*YE M]3QtזZ' A,]Bj d"ƽ69+].:0|`ne(k,=byL! Uu،H`=kgnl%5'`p$.zf̿1%QdS .\|a t?.v:')ͽךlOB}.ݏ;rG; NIa9 Z^lĮ.[%I7:3y&ۿg=ozǯ:t:L {eFDN-K͏MO+^9 o/۩@q@c H7¢04:)585o5Ü{e6od~[lCC7]JEzXc32m~LjN\a*"^g.\kV9D9fI<ց~ځJomq{ ^A eri;jHՎ?>D`Ea*&DP]%74 H8ʥadN'XSe[?S鲌ԙM_Ft@NDqeE8=jjϕd6H(\}61|;AL`~eO͔["{/ŏ VJ6@AlH<%2jHQ'`Jq7t$"bBlS{1R{ Nf"O޹ɩRъ }!ChX^(}׹K / Z90/kzkyexlw2kq(R%PJқ䪛|Ik>j/`yn qfo/=g9Qyx8dI sO º`Ll'"EV.ApvLaoE.աlw؃Y0H`UE)9rZyd}T,,#FA3ߵXg9DB}Y6[&{Xg[aھr*Iǎ':i0#&O _5j`qYdbhuEXfjx2Q)ދ?(_2f5ЫxU5ΜXOO3BRSiYeJ0$g;{SƂZ]XCN#voVEWx@H=7Eu=^MZq8X-¸vPh7k YF); &3~%>@7h96U,A*٩DlVUA@TI>ƼX"0jXNn*ͰWu;+#he4mǑ$ݢ朵H2nqpТFL5/X#+mG!#5cI*V Q; :!T*Q(0Hu" vrN%V!<~ |fL3&B6 oq Z$HQk7~0 M ?E XS wR9k @:62 k>K(a:ivWw_x<,Tkap`חwҜ[3Nͷ ϚJ1z5])voYoYσƷ?]O ߀vo ѡ~6NL닓ދd[Sf2 9v^A^<.US/'8B}Olgͬjt$NJo IYf cn_L&m/)h:?IhYcƖ Y:ο\u2EYEdm+ɻlMX% .p+enO\,L?]NB[ {GJ'DJM[j:0Oci[4^fIzwANrc]M+ː`?8p?giL$#2'Qk8aKI2ϩ%X&#M*6 g3r$ w}:Q!u_`&'įיN*\/D~hbjQoF1RʞH2'G cٱ&耄_  x4դSi ?CT65iR,!ߠHy]$o?DEtwWEe@ONJȑL𲊿6?$aML?E| t4AѦ 3؀*T"g_1"`.i6\G7BKfϠfn.ߧ'Y>QFa`ԿwЛop]5.6 *f+mvdVk+ 0/f-!Dwĩkw\I,.euNܻY@E55 FDž\8cub!f 34Zt̎AW>Г\ךf]Xf!ܙ7~S,n|u?qα_R%Paི+h(9O&N^bݸ;.%E|{L\TJx&̸/ 8:f!+~)-[!i~GzYV\$ֵXzTxѷky{W µOx} Tp3[#1'tuB\jN[]uoiɮW(JMt*<R]U/Z +OrgZW\\F e4AhSth'u+ )cY˝\7hwƂ`‡PT鷅{cd]qaX2XROڃ⷏}N۬-L[ A6E '?)>$V>-c-E3|CfqX3}|3!UTF Fݦ{kÇkGBhߙ* H{dGR Yg` SXgl(ݨލP]}8Lc=qN ZL?yhD) )eFTpry^zDn9r Y%eq)OI>Jř \h^ChkAVOqf"uR$er|\)札LX23t& fY}rz˘EHs.lu1d\I7gIwVT؛,ʣ\w*JqK$ 8onԊ|WA:M[DuMD0K@𛮃Vɥ/Au_ĦE)EsFk qIɮRs Ad sxcš+K|NleHa ARW]e$ mim%5WD5ۯo"XF_3))\\Сa0޼$VrUZT?5۸)+1NgẺا$##CXLR3ѫJx7,6/c60'(aL8ʧ t4 6 w:D1$ek7(43Q&Q o>lI-T*YS~")_'߳㟁K!`(|CU!^&=MARU*Vmpqhsm2Nаeɚqu$‰Bwk0u&A,>'/A#=ga5S|{,A|?FfiC[+0)0!` < Mm:x\%F)ZC{3*-&vJJL?oM;rʰ \em{&k-!j5 #UhŸs?[9S~k^S[Q3Ĥp<0t*8Q}e)b $pYce]%wnT(#AhAgQhɔ2a+=*:Q i˖ eG I%#HMlÖ 0.8@3ӕ[3Jr "ޝQ]'fE|ζqw]9G%zD.~7ФeZs*fH5|[=%mMWЌ[V%:)W>ZM.o)hQgj Jbic2$c"gR* _WnN²U/'$&xbv岊G|a?IiB` +Q~ؙOO=oq/e"ц\6:Vq cZgAɓso|-KM*JΙ#Zm *Hӱ WjT5(X=sIoIvڲrཐUqsVO pi"hi'e֜t!;/֋>r 9'L*gC(PUX~5AZWQm4HF~<8."Ff˼S$]O$xټkI (^f_W͜9 @"8@1FW_!(,Q!T\F(ȻF0yɧ_m&k~N[#3w`6\Q4(UBK6-TϚ2);):*oAT6KX$^`\I>Dq޼D[}@ZU84-o7 $ɑGSjߜXR9pf#Ф) & l.?Ͳ>^[4Ǒ![*|3/>}+XCG>NKTu!m- h@?rs}\ 2\O)@U\+ ].>xQX[} o1Zy-W'/Aإ3Qj %ҖH=œcyJ`& }nĿJ\+EԐ HYNTnd=XCL#(9 %*cI(a]xYhFש^ʤ)!D…5g=@s^*W9x%E&tՒԊ$٣sȮ~۲s3LaJJFDٸbэv0XvHF~;bA hl'$# dfOX+cf@Va# u24T[mC]{5Ƿ2d]BŌ`"@ \X@0LzmV̮BO{`FFeeQf Z. ?c,7Tbus޻j2=~%0HC֜zT:54IDE2L /j/}#u%e+EW`frM,3.#*Kk~3d| XZ4sD#Q/GVvkARlP3B˝ET;ɀ(Q\ܪ%gΒ7]CkVJu\UY-k:ޫBAB 57x},\N^[{jk6sQص-f"nF Rf(cAQG#8uP,.zNts$0”r7?|&ڸv0KM LCQ 0:ܴ\<~d6s*! ";"vBJʹ eՎך2gQu;O_۬NVt oAVZٿrY* \G@$ GZ^LzeXD ;X|`[y "◔C(G{Q,d R^ -qa2k/An f"5W "0S6Xpf(1ڟ5$yٜ1ݷ6"l*ONO/y.^it#I~DAګCvkrG6V>L֎"[m"Bq,dD"}l{g Ad= g(1 3\:Cq(qAt0s .P>3#אZML_ ",p@KBor̩t x*O/f6{i)<2Oʰka7.j[tBu!ujRF T2u*+F*`ޜ@5y5"Kb:.Rl6w@bŰyA kLlKu Њ/SC_%"Xhg*DU!BLIfzW03dtԱ*PiBo \Y+hg $))xU*=çBZcKͰ.-& + ֲ-3=w|~X WOv~7we'$!rr-G$҈+ &hA6,Uz s 73&׳p"L-1; ,)e|Ŧ o`~Nn&oR()hog.U 9P8̾j|7.ktaMھgϺϙV.oWsw[v0m _\E\/XϱGt'Fݒ[ ^m!L4qk;qw̾+f0iGi-' ZM:i*[ڰ,FXƕ8t>\y"=%Zڱҷ037v2nFÊGΗ ż9:Vt^DdƩm|X$A$72A׻W>ka븅m"|$2W*Ch(aS(zgr_ЗeVz/@*͒j82`/sNWQ815W?CBL} CRϐhXlAfem| /003txX@ E nA'KxԨSqK>Ƨ3D.Sj5çw]QY~c{.-s U$VO, O<}Mri ۙ-&mT<0c kŪ7÷E w{9v36 1gNmk6)+>}Od^gӝ4Yf?A^9?g-3IXjY@ 鵝 Yd6瞜̣cteWb'o[yw[+5(;rsN \ޚ RӲ(!D@nKXτ8ňO\vza8XjU]կK̎VAe8gmCa`` 6MU]eQYNjMeSP.f1E7E51sT+[%&0gs5=c0x.ܧ1Jh@p& yOVXڮHql;VWANp0ˢeoq- 0li Fq@l(?ИLY ZŮqmy0.IH M$ M0DlYp_hs"C.Qqaf*ļ^ᵩ)y]'> UJQ)آ[ā$rtX8!@FjDDm*EBo\Yo. /JbAi p?m2K}'n΅!X)Фwx dZ,yA/*6(w`oǀc EBM@/=a:&S\)tkcdΎa};,X&25JU$^nM(.)ZjVz ώ@ kic-;Zgsf^sRU՛~<>ل9v±gvS.PBUhE &4(wmF,[u9r] `] Y}׎69fVpլ7bl" 3/{ن/;sx ?=ˡNyd pއffy'u[^#UYf򳶄{Дr ^ax,Fi):GoG2Z0)\^!D4 ed0 ؁51๱y*R-vVUlI(u wnc1dH.ʎ㳦soJ'|o=۝x$P#Y>ȅ'ԫ\#Y!/".˘LIc*|`z)dTG@6lb/EۙnaLИۼ"kI4VNw]8J5wT 6'ݽ]2JrxIRLi'_*,<=a?q onmG5WWZvŠJ6W{\ qn)"!Ci&4 @{2֭NiƹQϾZLqϾմeJWxqSjB[<*Iv0zr9 mV3WvK .Y6}uÍo9o8/1*W1l9HE(+ uzdt!BS`r%b-nA\PzI65m69p\ Ũ+wJZqW'Zle|+V<&nz%>P@ >='N$蚉σ{0pW6۞௞A&Dȯ\ Kpd :  :b⓺$*YwQ#ٳd77_yj8`m'c-PYJbe;bKQ=jʐOD;%9(l.u/cɃZ ӹU6 nӿ R7^(X$K\Nԩl2z-^}hyUW5Cf 9sHddV[lˮSP*sV7}{8Y+1KB8˰eޖ F3&jѼX<5Z#?vrL$Dқ'p6fHZj؉_.WM-ڠYdijNs֒ތ,?YڎVڱ}tm4isJj,fhIlwAc~Ɩٴi)@ץ\x,­,鞋14~le] ^.uR^ri5]_1.Ճw9ArE]%ґV7F,tx]ԑ"!@sS$^LY2wvCX\J.,Nf1%tS 1 a0%%%2-/I0@UgsP .+6䲇ؚ_vB \@ _Y?g=E nUaqD$bZ^4G_3c~yl4UѬLȏ&,/Asoi{R<jOZ&Y9F~&Q5v~m߲b\+\~Iu-)ÏO2-);Za1؉tM{#l)Wp.ted"ɂ)4'yw&@k@b &HVB0-zUsAy/ylq߮kE㥔'ո $1[2o 8g _6ܭp׉Rw(/l At\+ 7Zc\}jпkK|5n?rT[NZy.blNz@Վa] >,ʻiV]]ƾ # r#1 rJn(!c61(q6)yCZ:׽@6v ܳ)tqK+j} LjLŌ Aph1ϼc6(B׋ˊBRPJˁ90"၁# Pn}½RІSl8z&fM_"MBK#zmw- m&sQH _9X?dp"ZhX04P͙ s934f>$Xlg.&JY/?)8NŅrU̓V(ʖZ !FL4v{US.yoF^ǞYۜ 5ѫEb2i3 5qmAjobR9!.Sp  (4h‘-Q|M{47`I[% B۫'ī!Oݻu%@POfĕ"]9ߛ;)ϊJqR="4E.nNyaRr$aSBTccjTA,Hy/Ufӝ)Z=!z# dTs#껞H(u24&A|-7̧MJ$ L4cB뷇=tӘ(>NUбrb733/N"D&|rdo7cbt} mb4.(J ) #u9OUk oz]VEiƆ/_$r9 <w "^7Y[bsP(v{Dh!yz^w01͋,]*gR=gi=mrc#{',i3VW F۞-It kH?"{3#A>V8\+7~\95"ƑUS7jQyf,:IbW 0LȿgM)8x R=jz %<䨑gK>ZQtF ͟w8ckvjɾѶtQ. rqƾm]՘^6`X۽,dkړ \.\ __Z:DG+ %0IaCH5QMm9? dB C5sCnZdQd Ť^Hj09r @S> H`I̠-#hsIۑvJRwE(5U-b r@OLhŜsBajŊXj%C*z>L\YV>9W䨫DeW-j ښKD.JT$NiO}꾔)NS1ki˥"8(aEQ2y:MyS Dca dZb'theX\&&63M=y(ss%yrY2g-ӻ.^B=feR +,g+MH&:+{(t=ߒnd%a#q86p"ߠMƲrga!{[K=4|?u|KMs\+>*d^c\Ρ0$f Vfk| ŗ9SuɊyQQJD_R,~u"ϸZQU9[\t0Yz]Y!>Xw?l4nj7j>rey,]k-D;} :t 6J~GjViA[%<̙[$'ug;-8iȨs*jfdQZɣU>̛,T~2刱%DTnYr12I2-s۶o=#,1D)^vT૬ҭ)pۗbc(JW1c۔Yf~KD<~4Z-Xc R[H6ebѪ+u,컆5b,/3`1oql9teF\;d`iH KQ TT6-2M(`bdo㛁c4׾\qw6TF0K!`v,i-y6P47I7 S Rqy6lҟ=ZԛO_s.Ɨk6(]zXAiC%b!gvS4gj0ya.:\Eޤ;Q\=5>;̣ +XH WU0ⵗ&:FWuB&kzj-Ɖyj$sS+sRGBw]2GuFmgB.>Ng  "(-4(iRv]8icBd0FEvVqtգtri1ݶY>j̴zk#aЋ+ݩ0{}BD=2"et-n= G֙lΣ)c~Ο0 @uD !(wXAOi=[0Iq_.S5<%޽S3cQj;nMFiWZ93m,w!Lf0`V{a#}>{El+]6J.rS ,I_Ꙓ IYn=$~eo@X %kSY( МmL /*Ag$:貍$5(ʣ"4gStOH&U븗[K9j}﹃S\řnW"Uj_QƟ{:T(Lw\rct,I%Z2X yZ$i?}[6jKIZ*1ZA`ۀxQyeX$idy!BZ HIv- Xo:w9n*[@r)TZ)l(+'"0a4Tڣb ixi!HvB#}F ncMt 2YPK :1`CIX b`a3SB;˹l_BeOkvp $ jGfp3+ !;T[KK/*-:YDϡ|:BbنD6 :l}V%7osP!m!]GGp9΃,ڑNb}rqR|I UeEАv1Kzy2 -rG*&8Esh8R3@?xBPr!&쯛,HA'3j# !DJ4KTȀ(l҇=/Ĩ-\x.M7ns"?Ki F ]NY{ lmH)H:+2ߊ2b"i3=p+etYAZ0"O]6-(sQ7!W.`zd U,A+'_*-4KaӺ6@n@7wќ$#/ )#lC]"r-: LxKV ʠ0_sh{ːY h-,RKr1gK=}Q=3d\oP0ܲ56^ zp/έ oZ:'{o^{K^tz~SLD6ӆXs=D2Čʐ)J d+0I E Wr]6d.} RFcNг+=.!QF%y՝iVW (i+fܜmÜ`ʛbauؚZ:稭@j9:_y9ԉm&";"@`HF8xub>b)vW+(56~ۃt5=z\ni&„GmI뙒ئ*i]MM`Yո+ClNRcX/2/[.LdzHPR源н?OBA*1_k TFٳWTDY[f=`@D+҅MN)iז^]q+ߵ­4j[rᓞ{)-E\-t5( BaÚm;3=-<7rn/=Br=5(VT2٧L0p ݃Q~P z (B q#1f1OKuUJ)EgO79HZ(۪4& Nf( Xbk SV92$>ypIFdk!o5J$BR*;DG []V$~g܍O{JF歠ث@$#S8B48&@Yo\&M͋Wamyl@&p(t!ʝ|۞Brx,t4,hQֵ[rs[-7N{c8y5'6Mcv)rp2{:| NR[B\gżX\IfAi8B;s$[r'ob) 0_m Ndht93r S 6kof竰…9@HP0SSKei+-܈ yCҜѬ3uOVnrZĀbG47IP$E 6 $4Ԭ#0XPA swqPpچ Oۀ8p"DȆAaIC[0J+I:;.TaR -_^Npq>LcHrY|AΠNb{3Y8mk|nq?1ʒԺw][Y yt BcqRY{U(_ b]_Qg10?g`_ozőՕDžX}i ;\ݝ'Fƞ3eIrM_`YZS*p*&"ɋ+Qf;cFAoU &[b 1=3 ~0# 6g$ن= YgfKA"ߋ9=+ Q +^Gqq1'\-iG_vlSûm !n· teacUlm-$ 5*ReYsiO/j1.82< ټe> צ4bMJ!4Uxi=#$Ъ'u5V$ĿE}QLhc-m]1]C,ZkX 9[9Ƶ@MA±ck<&" @#[4q`.޻{8\u57Vcv(9E "D빃)|RRH@֢x=(Y%ݺ@\3NkgvnQJͦs`evS"q~943ղa ֍xmMf\"@`4d&L<63c-sLJu ]:IۆuʝQTS*ܹ/ĨRp]Yû)GVۉ9J>\[Z_}ڭ]˓}FZլ /JԠN!\ƭvFx[  Ǹ+w`Fz4 +j]m T;-R[+\ ae;<[W`IN3\s3&ȀpfU( vUSDDd&:c}YD%̉odG}gq8"](`͎Sg5B5qq- ϸhXd2_Y FnXgc}_4NR4kj;5j˲}w'c3e.p\+6Eê\p5_v&*w*H,5 GsC6}0uvy459sZz[̪9G}o"22} Pd\wRUBXrjv000Si%0YjD#3ݵ1V#?p蕡hS d"XNM{%sz{Y(3xMsw\42+OWpQ&.89qRrVyJ>.} Nb&Ve&u.fVKcnœ9,G}l",#7[5 #!r':K xlb1P&K܁^vpC7XLgu`ӛU"j z7C,8"Hc@'҆2@EN"*q$] 1f `z6,6qĀq"gaN]qFaɗ5 |ܤ7Fl33Mn{ȵ歌4MksM_Ń- ًc PrnBXX7h%MrSb AU;oW~x&03nfKTR\G 6 X.c^bLgL㤒u38âm'z[Ḃw2m+"!RlI}]+7kUm_98|cxs&0U˅#U8m}5t-T愣9Ј6FH>/O;B DO[ W%B k'SPW;9iDW2CS6t|7Sg@1j/{+kưvl6m-:(m>U4Fx;-)}Vm/}nh:4ˌ䒮CIMvQ[;/bgz7ķRy$;w-y UʬS)Oǯfμ4WxcN]HD_8@9j=`Ěmȇ9 g>v(]9ꦅ6u#y̮n(Ή:\o@2oHGa-vOvz>=Kw Iwn_f/0A$;2K̎YZ|{Nb,UJeɭs󡂕<|&)B6?=pa&ڷ@hގ]b7=|';$:~Hp,oA%:6Ͳ% b:+5܇_5L]q] NV() 9zj7e]JxY"-/%ச]thW5ٷCe6~pفсrWI931F2S l1aG܍ta&;g2R NfT@Ã,뾧YIm-l֚DQGwWǧ],_z[եMI^Ǜ`):OEq&n1w͢k w!{#jCRK5`h/iGկR~H &vBk[ OO9:tc bGvԂ xNqK>iWo1p$OkIwt*p:%=Ԋ~2ȵ.9: rN"|cOyj-Ʃ^8Sik#Mzfs%˟P`W+-T;SNH[f a: >{.d]5p'6M|U)(%'BLq>QE}%A,&FA Q82H  q ݶ6-g`vDzq=YMҴѣEN|o<8ϕbGɆG0 0 /SEOw+E@sWn?WQ1<\}ߩtw۫r~_-El&w_mgtoha(\#u[)i|m'պC'oa04eΞoN~۲X!i r@SRJl9,\aܞWc:ǸK/֒:# J*{ yewQVi(v4l‰YaQ \y3斎2Qy/%wܨ/a(U?"*#ӸT~СEػc   f8ںgd0<(7ܢH/m\?e߳-w:lWxomlok=tcD6UCX@W@~[dQA`D=@/P**{%"(]\ )n_i;3s]XiP"H} ~#ƁD eV\s?]\1K* pP~ aP#u*AOd@K)R>E1 ) V,E\ HȊ`!Q<>޾υSq]_Ë3"TN▜z}nQLb!'LLne5@fK8/_~òdÛl6x&-PC%((~$*"Шr#/@H A_}n]Ȉ~ç+$Qnkh9ƊlIJJ g]u]uº뮶뮺뮺ꪪ뮺w#ON<40I Mш#BM4LcTqC\5]u(ӕB Ӎ%i֙udYeauvi瞺+馚hiL=tQM E)4F(ibj뢊kjihs$d2 "k4t!`@̉4&n6\q49A%([@nACZ$7@O-Bm64C`Ҡ?W8iHcU֠6$w0[T<_CiP]"+Rf1{z(sTP"~)iPsbh)d@d~~9` W)*y`*>DK E, `>yaa`5_t4R#XE?--(<@ DW)Rʢ=w:/t * O9b?JDb<,O}R@ | B rPJP@PO>~;?CR'㈯+eE@xmdpz?ϡNG{il/BL*|]ޔ@bA51'CJl&!y s\w_5E/Α;0s@C֐u$EO{fp{':Hڏbq?oup,7SC1C8001<^K>C*Cas(yi2¨T۩np߃ xx["֟6"xH6!mA5ZjHQR߼G/!D`hJ<~ޡWנu{۽Sq;9uIIpT0}wo8qz{z,PNtl:?N^_#oWg-t5NW檧?#TluLlA[wQE|owƘOnԄÛc8Z(8~۫ze%O+8o?/˴y.$AE ]H EnqWЩ@2A^ PE<@69RȊ_H!Gq~[|T T舠'PQ{QEvT]tD{轴G[  + dup5#5L\.+?<͎=^;ob':G$b!_FϠddm @6(DPPAEAdQ@$QR@&ATy( Ƞ*zd!Υ MJEC">"ApE W{J9TlE]T@]Ug&".@@8?  lUO)]rQre3xP@^o` =tTʊ C̥UP5PT1nuV Q4`&(9PQ+cHHtQ6 6t uP a\ZX:KLئ.#NYLt؃PqpLTN pUD ]\8(@@9H )b `""*)pR  6@ tD\0ϏDYLpOub`dO' -F5"҆2Tk77> PqQAT *)&^ƑM|A}*"(OM<xtow aM҇$LzB(9D:}8jQAv#[T2E Ӈ6P6\^}sA ^Gg8hfpCNd55Q?f +老6AqA͂ fΤ71.G#؎ "t2r0 f@ \CUʵs :9&v kMo:8rpc7Ԏe%ط (A5 'ePAqD͎l4'%*: ". 60*(*H"T P:HDE Hm .Hs:h*@nvDhӫPe@C]}QF( ]WMD0EPTPScU2"( U* .x024vw/Ӹ8>*@-N:Ԇ]\ ZP>A8YԀ&TUAO k∁" qz舉h { ;x 2AE^CJ ;/U2l`NDLQ7D3wT 8P˂ly=LЂ"t;A n@j⊛h*qCSQ@R l6DЀH:Gs]Hb ynḧ;X8 !k Q6O>\ qSJᮃ bN:S5-eu9<5bp҂'^P TQAvO;x\O;8 +@b@jDQ9q_JbY9mdw.~_޲OV q1@"/DT4 /(8ֲ3aD6P| aCNFX.Uu۪)<~1l!qC"(-]؆t DMS ?VEW>2io5.W>x]:q{EP=LU9hT"8{41Dm7N21L#j&mZ&Gk6E)8}Vi~ZU}ȝoop`_ԯۆ*m #APA>T.&tUa ̀5x{i9C;>fl&$TrPAo8؇{l{;CJМh=XqNsZEq4wNW6m 5QWf⠁(_usL s0P6A^[в.|T_i69"rJ>kuNj$v;+CsPЈ;9tk ESu8k63b..H?vP P=A_CoN2H~8(p_F{@~rqXz-ϕ]k oQT;X 7D0ǜMyWFP~b=jo\ r:@⠨68{Wý)gu kb @Pyؙtro# ;c=<+"w?*# !p_ryȃ: *__,j& @[|Xv9(=u[qng5:lm>tP/s}ES5҅SBfnjvQ"ء{aNGG(^JtO(tE:'QE_ DACw2("rSaP%DN*(kb9XxPx"pTO"`O s#A'y r_=wqz Nf"ՊΈAidGljeA(BtÖ7V:Xz@|,PM'e84Cj? J 'Њ GoN{p^KiL*r0<@<|Lz:<_i?" H)xAG&xޛr (<}W;Jn?ӥNhtQUmOK8'q;^@z_Ea}DGs pCћ/Wq)` p`؁wwP|{G5z^>xr_U<2Ec]3qW_>v^F2#DGJkDC@"QҼDDoU}$A2a`g]ךyts@7poX@ybt79w3o?s[Nz'|xKx/qD>GANt03U uP2qԜk[{=W@ބm?b*iϑRR"wpD'o=]Z.T|\"nx4DN> uQz mqw@=\s*G.āT/GEwQDzh"q]DyI\'[{NL'G&\UO&||?.=< }H:?mmwé@?<8"Lc?.pFKQboG*T(Wr;u_`?0fR>_DO;O=Y_K❔U^K^v}좫`dB?^4t84uWuyxk:h1|vfE:=eXz?]E|=\19H'7߂)}|_q]_#G;/xoC,|[q(#O[yKRMTo׾4(pϭw)nfy~Ǧ, l!ࢷ@tZ3Y=?_̀h4 ;K,ʊr?yys9lPyin>t>b'> ro4g0Og{oޖ|Yh {JýH}NGmotl=\ >kn룻]u#QzOi\o+D~x# 'v>'|+lL-Nx/҂Gkn&} p{.L3>Eu՝VYR( @ ݥBn^Ha\Us =sz&I/^p*<6gBN@4`X# I2MTյrBIFp` ? NDPbB1,f&(b`ElQ %Iغ`dP?3Azm }rjpޯD"_Jz^g^bC !@@S)d sb5+ӹ0 \FŞ,x@]Iܣ,]rBQxYuQ/XF@0ŮH/FʏMT9*0F!|i^$;<9_I9>X _ ID4I;h ^~aǦw&9J RX>(O=a$0C1XECx8ʷy;ruB!οH+8 ߅MH&3g`ڏh)J, = 1ݶ`68G0vd)aOe8zá4;gG5?R& uAGԛ\{h9Oo=>{~wOrzOVwk:=SO̳! d/zGfs<6Wc9c|rH^G~9T`u/tF?yȻLp\֣1<U$:Z5** fK_L@hzFha絘<kcWsnP{9ͭ@/VN'70{%D6^F8Ke0b ϙzFEG#6 6ŲẂ*}Wi~s'Un2T8r9t w:!"vz[w3 >@w0m{$vmp;;3 ͯ5Ro߱:/h䱍'f'0_Agw8kdhWJf~&(WޗZVqqfX ([e-D^/'v>:R>:ǜRx_;@ IB >*ۈ07_NB n[Tԡ˥'h@L4GoD5" wVڠ)[{KPr /~BPЇԷ % ,F(/T GFqN ɷ8PE"d.&+&QIs~/D~{%cBTB}hI\WIq DF_ӕohΆFx2׌-uOH%K{z?z~`ֽ9% #$ޤnʀ)>\8:8`Ańd@=!$o"=[~BtF BX(U-Ϟ_v g31 럔Z!&pPij!?OHD#rs20|&,qJA_>;h`9?fzf8'KKY07!9ZCbY(˔SBcu{ bXlx @L:NWKZ6,ڼ?0Pl@- W%Zɱ^`\?6\`C #߱Uy+|uj`/! :`k/>d8:3RЪ1jG 6?ƅj8Q)|k5PϜlQ2&?rNj}՟wC.3? n򴴻ޢn!Ӆb7-q[Ǖu9 u)-sCwl5[Yo5uu> AQ7qSQ+_ɻ|k>xg ͫL ЗnĻH2?M$4S`_9z"('pGGA?='> }3ӵU9Or,EF$0 324lS{i].o / >e {93=fNLW]&d"RXx+ῚQx:(w-"sPE.^>Cm|\b:>DzZTq/GxpК=O[w3riSbcp͇h;^3ACq|Nr%A (&|} ÍԃW'|_~")R!:~[SD<O<ˁ|SԇYوy8v|@v ^yϳkoGzzTX>\|6rb__K/)3F!p i:]R|=Ci|aQӈOrvpA َ=C<4#<4+5?BFeh9He*_NGvs᷂9ϵz@zB<*b<_=P'y'; TKK!{8bDC{ N>z\Pn)2xHlbԂWG!7SIo?_gnom^k~!z0Oq@x"ē7OWGKv젛]4"+N'1<9q4'̀=WI/'?q|`[;]Ow ?LGOwMSĔeB<KëXOoKTMNp9H>Kaۉ| duL_g/!f vv9p4{T|.;=}\_5Ts/jGyP1>$ ҽtٗlykzh#!|xJyלּyNmLT/'sVuz̭q(xߨ|5yqN siKBN}?&tN Dz]\].~@N.5mc䢼/Mm{_7~S@u=y<}Amazx?wqy-Sa+sg+p:`y|d@vlUH8/ݗoWCYvwm9*faY;~|LW<ϫew6ڈog1Ša Rsc$qjH F36NrW*P e$"v-[y g6 G '{(6}$N}x5%vɁj*| 47x9f6a# Oat\R' }b~$PnJd:;_?o;Z\a(h 05KDPUl:%ўɩiWM?TX2rHc$%p%f ^ec!X,q c1:DJDY ( U01re2DY))ͤcI*g_l}O% +Yڶ [On&ġ)ay*ÛM. ~Dp4ǽZ_dGN:P[XHS0@7IΡ`1JrZZSM.q%l nj2 zN+̌5J%\{fzd`RL\o0p–yQjfqhQ00%n}FH\;8夼z8wz<~p՟X -JvtZِS/a/ |,0 yMBrɗ `/$H y]uN9T;(eur1 _Njr:~hu1d>/̝^w{eM8wH{QUtSuZ=,Smc=,I)DqCD!iNB+@=L}|WC ^blg+@Џ_ˍ;HC6潼j/ ag8n@|$O{0G@O;1?k=Hpx_{#`H`b.8.<`p}p:C-l0ogѝY@o"Ӵ{(V"}؇chV }_i^>~J=v'&o?ÀU]ּLQzyN/\NKB> ~P->*bx%u _?'̱1Ԯǀn'#"tQ&G P)"R' b|>q8>yh>;|eNw"@8il~Mzubs5~*zn޿72?Gc`wP;~\|Ncsxmzx]gsK4[z (iD=): aҪ s,[Py =w/ul=*'9™z.ǚb8O@}wQbCg=G}ow܈c=D=CD}A8'b{Icr @|:;j .dEzx~:@*"+ lNyz=k^K,gJ;A.ЏPsO|>7>Luj?u>GC?Yut6п+<+f}`s^} iw=Vx(WգB6 nHA7! !5`i[2\y36D [kHxO?=柵ke:&(P8=28pC(C`i P8>s't~koz]Dtx?s5Jo=5E r~=mP*xH!T'̂rzH ȨHiD_|T̂DUH" |XDw1E6 "* *~e@|D PVHHZAD/$0Bf@ AD=Q@"q@*{؊ h#r /fD/D[U)[z'SS.._⡓g{J_C 7p8?^q^VHI|umi@]lΊJ*~@W<=4P,V (?z*~r qQu T6 lQ%EuO-EN ]QdDTnJݵgg?P:8W;qL|₦vP@܀ n& rP@=lP:H ""9Cs ƀ # @?L\Z\ onD3yC}tS(eDEA*=nfoR%ϥB H Ȉ (DUC>&"aD)(`d@8($vJE|@DW"?v hQOT_|~^93B"H'rQOS"(QUM_!6yv=tPT{h &9MH j)㢂` )D 9=qyttNtTL$ΈEf rA\N)` rpEx>G8h{"Nvz(H~AؐGuAP7_GAoiN7ACAxl<5ڑ: ?rPWx:Ӏ HHH $@pZ$ H,$# !"HT=?Vo!$G$Z$H2,$` )R do H "7A D̛FQN"tm N-B@!=DC1.y(z_>?mF%]kq۫+7ΥD^UIX(Q*yXyxS4 R$Zө&x ~VWv8(Zumvo_gSڱџڃ;}@gQq|xơӶmjNXo\wk~mx;OXxl4hЇw5 G?c޻om_+:X" =An|I<\=_16P@$dU|L`T_9.6,"02 EJKg᱂PF&%H !"`QA(ER@C@ TTy8 G\?*+`;hxO3*GAG. N;'v*v=r!D'ax-(@ |.m,>䜽AH+Bs6 @D0]@x>Yđ}l;v"8Y>wiI#OܐT 1=<ႽH,@M}MJĂ*8X &OBYQL(m$T}:z#òTVXLoy\m[a+G!GZTJdLo[^>HvE.ؔUY 7FaidҠ򺷇a)sɥml,̦Y4[M^ĝBa$;,I`3re*@`n; Xj:j/j:u]k7i=aCȜ\|kK;g}2Z-IlGI3MߨBt*qZaO!)kAy$u{.02Жߠ|yoS55ebUS%Oa% IxplT s"M<w58C7&'C|9]|JT;Wt%Jiw F@4%K-yTj3D@EtFq}#!4l`OrFL pxsC:b{H.Ɂ&sAsW dUޢE\LAVA8-s/{VeB5zx 3^VW暄%c2=TSQ33&'52N Be¢ӹО&폝PTS񉰬QhM; fR+(nO&@q 05Ԃ̖ @"qhL3+'nq4%߬Qp0Z# 1n-vnfMfJ+BN*$K4\4%_̞dNEwL)Y!bH |d#VJم-{G. qi(Q`u$ V+׈mZ+652jqn_#S Pq GSs80Tmjne7}h<0MU-s7n]E:kR n c~WI DAFov8bd^_+`BL&^xc @lncu'Pe8aU7߉hvP@M՛L_k qA iL,JԿ7dZLDwSy.zuAlOPX@θcAw$H L-i' L+K_6J}~cQ.ҹ_?{YsLgBoacSz 'kuܘO 1FG7qqeĤږ#(Ce53{@[|~ۿ:)I:2<xe) NOEkb{f$)mW2QFڛ_Svpt=?]?kȟ3ph8ګ.ž;'6Mht>G2e$}u^(Zn;c,VڈWߍ;q^j-ˇmqw tS` ;כWCַ8-?.No9P%}Vl?cXW?YFVۗ/7{w)Ðnz$7O7yw*>su-[8νeo\Lޱud1*e.QśPpOze=xR)[=M LrUy+H{}3rIr?gŴyG%^Gw^>6X_92v\T%Lv4z>45w};;w1-ݘ:{q]bWB,t?"eIzv=M5-1^%u:aU-{==wgrW{lMi诧Y4yqʸ,vFZwm$-z_~.?kŷ+94%6i;mF3Awjl;JJ:ujgm}p0Kxu7OE~ReuaG.** 2>e5,*(0AKE$  Pz~H?eBB#"'zNLM䁊}X:)*BDlx=^+!v0+U?LsMi\8p@ʈ|6pH\%* ng. O8XSCxZ%&b2B3K1y<4,%OxN"u˵C$%s %$񌋉#LکfŤRp !]F_loq<9oyy 9..\EI,BMCA* P8=P7ͽ@%6LGBeaw߷LWfP9YQ:x STPg*)  HD@H!") "*ETҒ2?qs^ J\ZP+uKE+gQt̀k~&W,ZE:MR))E|H"lkJ pux_M7^wm)j=G4i%$ȗ33 k 'N. n 1ߣVp izUlha4aAxJ`2!ddKy[kM cb1)u4 aAE)buحe0ţ._,@6z!C$q@sy 쐷ǴW~3` p,K )[QiOcxTP UX(o.jPj-` ڨ A"$.Zs1]rqkXFa2"غ*08b\Hqk b]6u[s7';-u* ˵ 62ŵW)v nPT[̖9uׂ Kzv6e aK3  ┴"کAP-eBBsP+BT̰alD,ڔ-d,ږb ~k- Ȥ/|gƎ$PD376 v6U BIRuŻÎ XHrIjȘ hK*Y' Zlt,oFf7Y| Yj"gaҹ<-UKIU ZФ1)j0._bʡ2]v K+@ BjJaE%h)Bk<=`o ! t̚L`\ +(V)dTX(BEt k Suŀ^%Q@L(20W2PPA#U!HQ6$ZQ,$#.-K]nB_M2q48MH[MQTi=БmjLPǖ,Mgѥ# 3IL4ӆSS3`DޢpBņɵȭJM46'QE Ś(E( Yؼ6P7pT\uWiˮJi1KK(!k6 Be)sqEx{,_C JpKY QAufB/dco 5aM'm:kd2 NaW\fXˢV'H mP*TJ34TRPRi,ZizR3X"C:DZ8rJ3!3*eLJmS*RpĮgLm(AE:X-f͊6)NUMYNRS1.i4d%Jr)S1*R"ʊM]!i>ٵ^s]bAp,j 0T,XpJUƓƤUL)V8 Tp@Jbi7$[IqWr d[SWRQ@SE%pDR5$H h \R%ZD؈j锔Q0 ̤j\J%)|ڝT 1 `U'9xvBPD#TP8X*إmj[Ja3]W#jY¸L83Z'j8DMS9V((deȗ- IJX2$X2@PHPrZ(%P UT\i-aĜ5( _L'/?Goq Iʲ6eIZ2 CXDmE bU B`p\jDGED&& kLE2uH-AITLod9۹d&$A0@4u ID )4E$!D/6 53kme;3!FQe7wP+Ҳ%DGrM-_pb !PA-Tos/qd[1jdIHA 0B3IFҊ!_ewakP9zDv7.}h8.܀|K%U"CRն(oYnDžrTiN@n$8C 2#EٳS 5'kp%{\3 Vy X +@R7ušqiגAϙɍr8֩8D&hKXCn#+׵cGc4S`8ҢfZ%,:±^k}R}H ie+0B:])HC_Pvd,  |PU!8f3sKh6]7qΆML0CwTcvO+95 D#lEۮD_q֖| ssN'ÙqvgDc]6 @@jֵ~^ɎNqAjb"3H/0]_Oof WN#D^XJK$-MjкVWJyЉ(lJ_-tl-q{۱ڕ{Wsa.fkm߀l d1[ ۂ7L@AYZسOim`6/.cm2Betɔi YPyvLlϲn1XhK+`ћU^^:;WSlQ<H[~^y fLrH&YRI@<]"[ZRD暵{/U?wUJbz0Vu1 Nsj_cS6]J Q' m؝eLAHlAYYnslD2Iz֛Qw*/RY",~q?'`<~/hp\- -9s|^뮱 lmM ]K*⇱@,%X+4ܽSX"v^s A&L=]Ӥ֪]pY5;_G4Ea-XItGA0iʍ-?YFCnHzWu{sj]{w3mN ΊaO/4%hʺA] ޓx`YfڌJ9zHӤ^{8JQQrƖh;(θ#ENv+G֫IʍK-F%NXMOn_rAgfP"+8j[V X\qNCYƴI@B& ү*~R\86Ms=M+E+<=Z t<2"朢ʌȔR"G65X֔SIJjQ_Z,VT$g&JZQ4V‹@V1IN[޷1XA /<DAäjs.Ս<7̴ɺM"DC!P!3\IV*p %zT""y@Ֆ?Ee !IAl488"sy:Ev*kY}&F{!LDžwLzMb'4;*ljK]%lWmgO@sB`.sf]@B)X D)!MiM&'Zx75FՉAܶJy=b)LPs8ȷ;ehE#Fa#FcVp @$D,VcҰX[}oS*\]T /x03N W`nS+Eh FT`^Ӯc*Ϩ*t`h"g,Qs>ޖNUQ?*eM[4MJDƜD5)L0XqiXZ/Zlmf,`O\x:xAIJ nuw', X}m; %4 !`պKt0%e.#J_ Ws4U-1@dpJAI$wDAN`cյ[ Ie7JUda'(,EG+B lMV* ݆E֚'Z9~#ЎU<tljq`{ 3 ɻL;}w\!ϻC8Q I2L *,mnBT-6(] Q!RbiukH# )8J0 D/5,%_Sn"YD\hC:c~Ǒ^|ʏJ}Ֆz'4pCq\yasAש9k 6oy&| kDgOjf z5W<ҝsJsngNs˚QrmC^B]ԙD@f Va)qp8*J.zSJ_jhH!-Uh2S> Kٙ~[]|Y$,ЩiĶ"CssC&!!"!ri>픉*\r xbKM,nfi-&?/^T͕1[0K;VIHe2PȌb|Sy<,rd5 E1ͦVV h$N.tADP (΢5-0uMMrKFu}FpNq,<Ԩ̮}4 ue)a (JGb#HMUaM[@fd}SP̖t5+D%G]ۭP Q&6 P-M駆XI`#T)ѝ" iSHi3<2j+I 斩#3!oS R{ɊJ̻ }T@8" I !##"H,H!Ɋeg_~8p$*N@D0j`s$ΚeMk5,$u8+,XZ?0p8b蹆&l.M)5;=#|jhVr~|N༏ye5sS"Oi:4͐ygW4YqeK;LNPqzXe(,< i5ca; vjjf.TQ-6J@j[FK^`YWf,(YLv˽Oƨa1)օ 9\bfi 5d̤$;XP4 Dyq-0TY7:ȆwUV} ۬V.ΝðiKb:0^b\:OTj +nTx\*M .Bfu+@){Rf$*.yH%2#BHA~)$=$ KO<l؜鬆]M{cStH3֜z$ŭ=,-w01+?vJƟ)*6q/$q**'EM)YNZSqc#O@[(YT!cu+:,ǎdz-es.T-`^S=Z(d@NF+kSbV8==]őZHfOC̲s XVnmLC4d (@'Ծ*x&ŴؔgS[5Bk8\slQBL8"kH\ݔp"F|h1 f\]\3<֥,VB$. {9MAj,Wsw^J7l0Q[TP] Y`.UW"Yhd9(ywuX`HBʋhp"@3P0)!@3/ŵ !rȷ%S *-[. #AQSD'>=F $:127Gn? Z8Z 2f Ŗ߲cmq*E\@U,! aF4 ȡ T%~ $032] /`1 b% !dp& S,$f/T]uk7ICY2>;eB9+F: nHPt5a5fȍfM de.x·.̒&d2E6P`D^vdS2#;fN0 M 9OQ* Ɂ"|E. e(O[#6%! 4):`WࣃѡklxDR^j X5xE!':z95$Bql!n H)2Y$HD BDZ {7vd*+R-*MԴŅ}\ a@ƊK9ށtu{E\D" X ;:*6};k#hZk ub[¤Uw7^xf2@bRD)!\X@0bLҢdsJ{[UO!rF-w+n큂=b)j9Q&H1 yyXKc sӯ BxD y7j)>ٯ FL\@)(oh .ii<ԢKY bHVv×,IpmdA3Fs5Sצyiiac$~;)eFn_a.uDhP_fҲ( f2@3¶ ta[KrgA-4sJ!vH*9;*AhAj"*b&"*MJd,ɋʆ+0ʛQBYҪQ=S:HXtf @_㾳†54.:[f"B,a9pJ%4R->ek5N"M{N3/;bNqHӖpU.j\shjO|CVtDpAc|Ӝԡln0ٳS6M0W,PTs =Ȕ!g9mF@͠Y(W ^0^Ya aD[o;-E*˄jω\ @`wSDH&Mn虅%kZfy{GІw)`!k-f%:n2h{%-`tcg3ы+leOcT,0Y XEe˲VC(Ҧ7+%;ЙZ.X-cW+J$Vl6y-/ zs{ ]vD.SJcXzg0N8`™2Ȍg(u,w,q&o~,sύ]Di+őD6GO^ PkO&n6*)H%0n켺ZEgRS6Bb% )f v;"E1ivm=X&5Z yer(29JP.-?}E:>e"-0' ۙVQS&G];̯bs=L@0fCg}n@MqI]3uIG EY>,bR'ذ+u0P}qz)P$e`$=G#Btٯg{6,N\QX:`m3blO>aP՘BG`=)!U 6;/{Zi/v闫T z<@,grqذ[.囪وQ͛в%L >ԄtmERlkIb;9$ݩXL aA3x cH,i,^/'L4ղC%{pʛ9:>ǕD[|/:5J,  &^ۄw{s(d$. bbi b(HpI1 `'}h*u$$#Id qD Bj P Hx*-REm!$&BbL^Wtm~WKbD BM6BƲNrQ BM!YI^9$'V*" *rk<2lʦڅ{?:}^f`%b04@`r`+KV*"UR 0޲Ȣ% )yJ^-'L$$wҔ#$H@D D"i $ !$ IΤTѤ8,B,ѢTLPtTުP ţ%" '-*$@_(E66VY) Lܪ oPF. #PZ--$ӷZU#rح wUYVDFՈIH "F:@  A!Yd@r?}i/ dXP*+Qi$B!D B !@DG2A H  EDdXFB1d$I$Σ)yf2&hle4@AAA]DBBmT$ ,B`$ P@0b VQ" H@hI RKA* IPHI*-*-$BA h hŦa*ER Q H H"87L-eK̪22.Բ6&eŐ,GLP!`-4HZ ȓ>;j&82$0DB:!DW/҂Y!\@IA&9|m☠ " A~4`j! D B@:)RB3PaC2"_tӍ RBoqtY&#3Iq J #"XQ I$BDdNSYRnuDDHo1ڤ)̝zU @8ֽ^xZ9RʴZb҉i"vd iڴsZ/?'oo*ZHB E00ࠪ4T(_,FV )b sq[q U#Ŏ%3Ъ,q; N5 fVX\39m\u98Y'?˅M"?%;k0~q}KgYәHy./ݏ[ўZ8IDdxs{=S& Hu\CA~( OUnp?;^g3d.\ٰп]7Uko(zqjJ3h.Dt8/ 6R Fxlxۆ2>3 {w̺aiA۱w&v*_On u08}!5Ŝ3ʤ0g ͩh>w4Z"z&=>!0S29`: qpL u,1ӉkM_?Ioo&b0*E~w(g@PCmD*1 H "״,IS lB"` PLQb" gk Hk.@dB@$ksJ@3 +# u*B@ME\A 0<ժET{Y`Ȍ<׋\@ QSť5}7a[??y]f(: H.ښYQ[p(Hȃ55y. Xm  An-F Z2E 2H(]} fGmOWm>XЉ"Z-ڪ,HU o-gEZYyQ[WXAY{r%ėkdښ(HD鿿[; peNqvV} " `6#pDA$ AP@R09ϟ:~{C EPat|̗bvo+ ] JsG"1N tLJ TB`$B$wPaGQA$Pp@ 8"f 0_(U2P@ {r_B( _W;@֍HU"v"K^,+b-I V9nֵ*[@BKtO t@H! E5 (bUm(d$ 8 HDKJ mXBJ@J_Hj nmk'hUF Qb,")l24A.3R9H70`#idk| "0nY_{3A`ፋJ-rzz]z #[ED&M>;0$obV XHBhS-m]~Fv',bYPÎsMR42jCT#qN"-i+-y,@ .hU9Nn9.1K_%XQ HTѺ$ Joy{/B|E9.3,$T;epHqKUi*"[4rKIIո"LIPtJG2BsIEEZʙP@D5 4t5`mտ2'~S()*!,^E%p_H0It\EC}U`/`27"D,@"b nWh䲴s36&*'X `AVJ6u\L-%4-æo0F6\9bh<ԫM8,nh"Jp\1@Q 1ݷy[hiAtК,C[l_m`iO G XLC10޿QNͭ T*ȕyW'!J zWS*JJ@ /cm*.l5OL^kJcWwN5e0B[&,M;>e**vt 9xӾyJ bq2tSV%VՍ`RmVƓp[A9NaRR:M Y׿}FusYbҔT* p ʥlR~ vj4 ]iܩ[r)Ih8ѪĚwLW=xY@.!!E/7@Ke*!tEJE9l{۱\(Tr\P(hD/0PSQ$km /pEd2Ծ(.i\D .)"$"ԐB 3AYKE3HHH )"Hțݾ ?Sq絚_aMd"ACBӺ 7ETSvK0@ $D@j"̈́W."&ovB*&l"HTo(Hq-1wဲ$ ز䖺 ufBG!@$ъpD4eYkqp+1ړ+ʘ ,+Dň "( @   'j9L7nl\Cڡ nqDNq0\Nc˄KI2Ha(Wm;Dlf?yYuI1Ή)"Sd8'E2 yx"QeEY N6ME*N5UM 1PE@)A]}oR ;@!P[@CsN a92D9H+vLNćz9y->!j ! %T5qp-d/6Ղ# ܎YaB |9mlD Ș`ab*F"̡OK,_i/"` R2(5T-B$=n֜.R#SMly W ]49 c!Q$@:؅MPE >ZhStWg 7@@ҋ~5N*8ahfd(@ʈ%"2_AGt$$Dn[nVgCEDOj_87pN"ΔF>6 & ou"̾{eECRͣ⳷y p3`{k`S@$-?1}g a2OY)I3/jI$&hm([Km&+2a6ٸE!K@%@$L&D5[[ȸ#Pt 2.T_MEAhPU J3irfWDdTmbQ/_}]1A1[c}dRDd]O8 2''H}6jNV&(W rtפ{ Hab%VƿNS-ϭsxz\o-g|snƢT$ TKj @R)#W˾VKMU eΛg1 IQЍ ax02o\ێ;lF2E4!4eha Ae -iPA-hբSt l] E hP 8*dR\6/ŗp(yJl`~ [)BI'd\F7_+^BXI" њVl@nahmqe2 924Uo"](o6 pѮL0mbBtu9vLAAiJ6?l~up 2` B@""нxT( M0^?"t8q]q n A*E)[=^Qv#|OcsޟaSt)'ikDhcZ~G7Hjƪ!:7+aur?N;jWB; _Ѻc߯ v=ھ)+*|RIk&*䭣8%*rsSl.ROm+8clgm\J: |3J6|kzS`u:Ъ-͹457Z&,dU0O,=IekmѺ@n7<HBxd 9S"gCYcB*(u,0oPWEʛKznσ&0XM}= β>z0q#*h'y/Ϡ}K{xph6NwIk\/¸|atDTOVQqo {CsdOv PDo-Z|"vۄ SpqAyVsF?Gg\Тѿ[x,Kj(O f5WVсu!xrg[> y p=+a[QNqui2YZ %5ƥ2V[e@PBȅTE-7ʹ+0I`?`HS`-ޔs ,nh?pC#üja?(2gt?& }ϕ8#p k 8GRO!)n2[y #% H(oɊS4o_Ok` ""decϾ׋ ZV PG) _*H*!h$ MHN3+'xm DT@3-3nPvYr . Y*lmL0T;WJ#t$6Z4l5ȋ5LRShXΣL}cQ3N. b$6\2'*Z#m;`B@G.)Y$J$mԬ`) ~Jv!16l8P(BQH0R)"#@Zn^\ x0@pEI4-Hh7@,M-Mpu-k` R.ʿ]*Edym3z9B!@ .Z<% 9n( ~uq3LTs.]28Tf.uUQyBuO)2#iCQӲ0Yopָ' ZJrKB tDم   F>LDLIȿFI%Q I޺|J]V~. `G/=(TP@ɤ3BaiH;)_1]WU k-Wo7F"ڭZ0B 6r?/!VZvNcgУvJR X5 BCC:hct`&H#c !k)CU\}#h K@U*jAIfiEsf( 1A7U$@fgRN#=w}}U|Vɴ⫁u}ec76MAV)dLa0$88yܹjVџ6q7|= Q-`BAVA)uWsuٹ޿'v:8{MehŃ'3qzFz !7#[W 0 Ԁ%[2hA<R }tT#tT:-0"Q**2" 8f^p0)."Vm QR"V(݆/N6*>"(9^T1D As{&dLDJ”&%ȈخSW8ڗrwS2: )t)Ye\qXX*__) @&)ЍR0i/l@1Dчo3X=U/f|H;="C$ϑut& ?Z-nf\w$vdF2JYEV6S l3$ 4mg)]&=J i'zɒ9ǃ"Jmd\JV[ ;Q tBb)mAW ^ a/sXhYޕGӊ|:cpMp4,E0$F5^c+~MP8 ūl3 |?C3ڰr>u9.4HeJ&TA&{>GQ<)PnQN6=e(" 6ZbA 08sraevJV!djĈhb:Z/ fC@MS3=6[-'>|fO0B4z ˜&*""B3ذ.x jiҌ })Bj36%B?E㞎/|_{<= CQz􋆤#"%0:?ͯx.6eAq<_GøP tԈ*9P"EKDں _!Z ) NncZ'yUf W̾O[U0@S22mл0c8>m5X3]Ud1Aύm዆BzSy 0b*D2#K-E*'Ej2]IK=T{1^$uB!߱C <4+jf^]U|@Ѿo]@W2k`dˀUԒ(:ثb݁0RJ[rn?AvQ1$4v>նt! FL(>-稿&(i89w{^lyj~em.|Es:F sZTK-A;Sl6-#2q%7a6&r?;vL԰*çN۹(VYvrJ~ZdLuKy^ w#Gv;lH㣯.tTqGTt+!vgrs}iyj l-kP0J^} D;O_~Ђ!'KY4j7~סѴdLX6xUMЦغFj$<BgCk\VSe"*"fdf &( ;_vk+R2Wg,1qu-x%&v ˳\r3&3I3͋H/ a cʥ@Yr#nfwi?Ƈ^H\udg(Bup"iKBf#ۂ~6L'`.: 921:']MB/(6=5 m맔2@BZ׉{Z2oj8GyzISW[1Hۖ=Ӄ(.Լ'h;s6`n9 xaq'j!`fHyEX2 PStt$Z~[kbҚs$Ap @A! A0 btm=!C;FQsb[w0L=#^!C@4}PxqP~u:]}SCc[*N4C6+:U'{ׇ;P2Np"sul |ܿ@ف0KZI7cUgINt)Q T$? ]N;Q1ITW&`7-OBRX$v,h{J*u>a(鹶j[:OMKϫ`z2fA Ů1i?˾ࡊ>KVJT΢wo4ȧ^cբ Wguslw^LTW1Jhch ݀qvb8fZU98*I)5"k| E{Ş;yrD/_Dߟ,Kt|`eϤ'TSž[?Z.dv2&,^±@8Ҙŋ2=oM_4Fxa% aå TETԨHȉ m}\ZJTR3B%TPJJm/DjXF} ck/>Ţ*4F5S7+aFnO(P8( )9J k$٤rhjDXOԦ7>pX҄0d2Jj_ZTf[yĩ4NΞjE=N ; %ە{rkbudD 2(KCypP2G|JmufUx4/Nۨc_ Gq#ABy&lqMF:0r@vY͐ )uhs" "] A74bobZ"uC yk 3=l?t!xww{՗@8Hq:+/?nsˊ;s\;u5U8w*7|\w]'lj^JƆ&²8A9`3sTu\"@GB( eAq12ߙB]ux=]l.8ZG*2`5*ud PD$TD}Kko]_՟k_v g72mPb""5&0fH&7L^LtrnL:[;I`VA *'\323>c(x"qmVE; ]ܙAQKeyl-~sdR-a \)=#W-eNEe>| t[v *ڱgLOAEKQXp[-e%uBZ(́ԫahKGW]9J['.d9l 2W]{&0qx%6}1 'YM?*ٷyrbk)$ j7Wj`F"ypNf( h&k0g}jH:b }PxJT^wvyy-TWm&wyM#'[Q45C 3y#uoRYS?#~Ʌt`%2^2 3 1'p,'PxWyD"D 9%%Ww_ DJeŧ_yPM篗[{ӯp‹Ҷ⁋vAP vq#{Gu=K".@%-U bƎm k}ay-Ɏx_عf@C#<?Z}?@^W@# r0R{ 1EI @]d }9qRve h E@pK⩂!YfUmo(7m x/"`2PԬ܃b*d1D c*PUC6ټ&U*cv.)ki`Erv+K?ͿǒnZY+șd¦wn\w}U;A(1pz.q`I"yjC5g z>DqAst54HoFq'XݪUЇvru+oz%2'I[;u}i2&Y'Tq0Yy/hCd b 沰f0qlx5~U*LugS+&>"6⿧z>OD09a$5 4_+LF+QjhZI*0]wq@1v6 8yQp˒TYKeНt9H4$"2SP R?j8ź@kp ơT*h6XR2" `Z#(WC±|IV-a1B:5''iɨOf\?xp8Zt~Ne%о ~Np2؋h? ^]-M) w_ i}Eⶵ8 Aq<9&7 q))@L-0TP>9U(eɧh>% mMvY^TL+&z(b>Fqt?~5̚9cY^3̷Ī/{k]Dq|(?r "ٔ1BJ8^fZ(^׍WO>k;K"G)~.Fb壺FNN! &Vkz86ֈyue efQ_uڟl N 0]D6PkjKL(5.BkU`0hSX)@$>LUd)-./| |A k- 7М1O>yDŽA;}67g-P[so|Oy$b':Sw0c m089mf!L&{H L!JJp*EYA|fWFV]~(_)Ea*%|Wb̴/h9E ,`NJ9c"*TR<ߪ}VlYd~,d?Ţ!tzyN$$ hJHEsf0"p&%@LTp͔D2,0FYl9ʼnrW (;b /K:ƶ\#Z0]qfї{- EC$rgH獂`S/@:ϧ-hly1qu$GLyn_E]{{.n9]T;A5­_~u1^'<ͤ8h "ΝQHF- ԉ 0Ŏ)Ϲ^LIZV!E '{-z.(+YT 5Я Uj}lh ;x. |}EިKU@wR86ꯞ^%Di8a9N36.\G`fCBG ܫκ˅ jWL(0z_ZooDb10'҉5lItX\ ͣQ޿a~Pu|c"dS! IV)h=eiRIu$N!C<ō} !i]\K-NDUZsʀN 5TS+FP g&z6&tZ0]ʵd/t@nr s+X)E}P2=2떞.z>7v8b nt;{.}3x~;i #i@yZz{cp@j+O,qxϛЪiyEx v{+TXlGZcs}"爐..7Ԇz7o >ҋw+'~wW{E| MGkCRv䀹\zٱ[@ ` xuq`XHNURlF~EtyXMw-bA&2+=te\Cvgܴ7 ֞S 6`Դ1m'rvuYl%jI1]ܰah"*$㷧֮R Gy@Imq6E !ƥK6nFcc{Q9zP Klh@5BM!TEsgabB*,q@  J3AVR{޼ߝ򷿑f F0& ( J| ̬X'/3Uy-YK%Rp֗AŴU\S*gaQ ijQH85Os/)qbKsXYԝ| F yMgDBh3 n]0Kg3{?>6Q3 D@Ll> ` EqC}7cB9&gc~)Q8▃z_ 1'V̂ic.㔻z gWv7 14߸n*t_JZ"P=7d>V* DQ1pxk"]M[c`m$ê߆fAD*--_c1BA||k[Vw?u 5x ѺΌ~}Ռ9[ iA)je+""m/05Fn5r^Es##1B Tѓޥs9=oCf̪akv8 ,O@҂y?3foBp 8ff%A`I%ä͖Qip3v4{ɾXn'RED,6A'蔅 lTu3}NH'+N]$D6Xj%Ȗ|-6кmbZжѺ D_)^1B@CM)1C;m <Ӹ^h5qҋN |L:2ٹ:\Ɏzї{OSuӯW6~CϷyfBI 2qbx}T1CB#@!'Hğ5 9u.Ȍ}LiSœdJKH'pU)(#a?9>:laU*|` 1elTUz!2)l{;Ω%8(T:N kDB|Myܑ:꣍#2%rTJQ$ߕ֬:E,WDX(Ts8 #۽43~UٿC1]I:85.r:m*(lxb'MjDvIRkd+ky% {40,ojc qfuCMwHnOYjn",E1Hjbow$JE3Z&>amk~}ތ`=W;_7V31wP j[%n=9a!+ϝ>`C/` a JT5k"NOPKz%3"+Āz=@_. '/R\*9\NRJPA <.6f~IuȓyL_0>T~їڟknum^=ծT 4&ᫀOeHp] u V}] `~RdY]2 (’D1Uߖm鸄ˊ *5-3@AWR Qt ~ ^n8Y!18xA9O)4ҔY_kUn``EY&]Dtr_CTPmPTaV+ſUjy?*X>y4CΉ1#͞fcT#bV3AODy6]A>R[O!T@TfY'{26*TKbi-ʶ|P`uO2(c8Bl`Ps㱯=Š"+&-~ş![M^Mڃ~B~ڲT(3:k. tC6 ]G@KRV}`WR.!b>9p$ᢈeC.H--mZ2uj0H5@7;|澔ئ\j~qvMeWdsa5RgQC TSbο>[D~v&YK3笑 (˦g+E0f?<ŷ:07_4_CD+E*a+4"jBD`%2|lt5^8䇈-TW(8BK|}iK'S3co-Z@2H~ԀNy1fsɈ:D*5]vMi @&.UVllDsБ+d$9*?Bޒ{Τ7 Z+V[&+;"V)\QE@\[fݒwzeJ% dl3Aݓ߽Ju[y'DK"ZnH,4y ! ̘" BqsPwsO:ǠEcǵ~e(#AbEW6K[T5FX5 ߴTۛTZTJ`\H`Ý6$)9~G-IAqdӖ s~lwɛ^ݏOzP^<Nڑ[n]xpu3%]"7ê{-m/oSNDQ`.7**\0 }P?GZu?5H+h.2M 4\N\+溳`u\3# `o͢=ѭќpܳlךEU+d ^ bxd 11oYWӑa ״K >GB?w0I-%BBEʗLJHҠ_BuFZ/ CFYjBe MJvUCiMf(-Iwds"iJLJ娩4EQQQ_k2G??cp4( TP,U`VEg.h*X@3XӔQRHhDPɥFE9I s(žFN"5 O27;E|P;xr>= wѸE3RTa/t(q\ŷWA9UUKNNqNJA6>3n>ǨQ̊uS@w sP/cX%2k[w0R4cҶ2HWJzl0aҹ*+UgQh9tu^`H+'{}=;>hL673J&2݂H=.b%,}uI*Yؚ^. oPnz|[qbdЎ!06'h8WQ%Ţ^;H5%xVyf>I`n#ZۊPZ:+ZwJ ',촰E+_).hԧnl lzMaqEr\i(v@@̔>xI &滗R3"4w*:Oα^ͯ>:mC hCIJ)8|>'AG,C'9).-NU@oGHQ(ȿjjC lv,F^u+Y O8M{1cQx>uS΂$ e+ȳȮt/5 se%2y3( lAŲHO&Uݠ/:aI"@N^Lq*wx ,hLF6E~Pئn>yfRb`֮*X7lj٬.TD]1֋,{.$iZOie D0 ,?禨P\^o.P"/c GB`zTTjs;ÜQڒy׫&CR\|{_y@#?Ep_Q. |/Z\sl뮴wzr&ʿBWT~SkQ.YW*rDB}M _?.^U:@ҕ,RS c"K/ߎІ9!ju, )jJ8K ?wC)2:c$솓G?4>4*S{OId.URhҒ#SSc@k9a_{OrжlG0lƟV=uiB/4"@2/BLڵ[%۝L="Dο?\'@3f!>8<]aV{d;cڔ_Xjm1=~/:v}%(%',7rǂSg=1lϵ <[{J$Jc*xD5C9$2rK~5>dMbܞUTD'4}XjZf>*k>>;ήFTlI<ɀzD 3꺓([To5kP`5n!s@>bT\mR-b`&$"A"65B2ÎOL4=غ.V-#V@~rWkq6!9yt*{s~T `,:/%ۨXGX; `qks'ߪ^3ͳr!-y{-ݤ)%hVY->\gq9[:Kx#ūem 2fʱ w4~#W%+Wy -6kQ)~:}eR>޵mGٺl8b9u-PqG`622&'w.Yb{zV|8/R8}iٽ]yKs7hKs/_ɘR}~UMp襀kvnzFs3Y 8;~AeŒ[{/W#e S_[A=6 4D@_g𨗩6îZݗ#k:9n>5|"uxq&QKZ;x Wz}Yy9P5P]Qa` 过Sw$pb*%$W.p4?kzo)n^\.lG3Nz?kWC`y}>)W.0I-,]F 9,̄$"f4/aknE^BDycRy,yd32ʾ`ͰE/9#nx=1P0 h@V]{n@BLqh ,)i#Qqv^ AQ0MQ(vkb,Q,*e@'+Y6Nv!fg]-E,LB13].gE5@QV+ %@zXDc HkLN"jj=^iDʕD9~sz:G Z -Qu#@ J嬧7m,HP `cOq+XL&lӑ/{9i(g<^*!﹛_\< b1ݛ8H/lz+9-;#| pLJ+{SSD#E'uosGۗ{:D pڟ#c9\B=V/1Y !; &)^bc4PS>cMlog/Agi캶9Jɪ /tս"ʹ|W|G~JuD7$|dq"pɲqq2Ԭft4}< ۪$<f #jNIՐuu k[5&%[-HC7%Y×-k'hBU5,;j)T݄}sdϩ,ֺ}ޗJLJLrLB 8dgD `a!34ql! T+*oBY.4w.[h"2|^a>ئw=3|?ׇWSq{L/k_JRXvLyT,!]O,2P&}4}X_H>p(/"]ϝ,K8t{KԞtТaD <-Ifa~&7N<͈H<wdX,xG6*2J+;|l3IP5"ȁZ󲗲;5b!"Df$s"pLY:77>hF6%vqb"Z$*rK 72}\9_"dTЁv3` *լ \F^0-jCZ.vb"K2F|o}\% pcqwBu(Qj $=w-ԳTwQJ&/j{;X{ ;>&(N`%f'N=cESQץ٧ $؛-BZDcTzXiR2-% _rQ XWynR$ LQ"0!" N@sc37iHfXJj3Դ@{u-FLAwߩ"@{`B|y Z^oqKEn@@DD/kzmV,-o'wٜv/8;Dd2o~=]|"٣ @7ГBStwX!'VN__%页od0g Ux[PB,AмI9q:@S0QÛ3w,(ʔ_ZD z`+Zi7lwԓ+chm;?AYF^`rk )o^? 8@qb릵c- qZYMoлC%N=,oٞT^S)5Ϟe5FםvQC>XIHA@ߛ, N̟/Mug@UPMcj!|:c<9yš-/G`{ (bʈ& a]b02#h`$rJ)I:S?#[乎MR޳R愗&;K& Tv+?(_yϻ8@S%ϳ8;,z Mlb#Eʑ<%)(ǁ/ {WnO)?O~P58>dPk!BOS-b/%GL{lτU0Q066-tVyzZM}N LT xU+?fp/۽e^0B_c]i[M] gR͉hT$5M?*5;묌ckE{lrYan)+(A$6-0RNq BͮOA p{.X,CQF EHU&ּ*WjVBKcQs6n{t2ϛ109v*1&Ϥ/WrN$PAf@?-5:H2`󝧮 M?Y\\ST!+ `ly\Rg$y9H  JOZ-kM@ m2Qhk6"_J.9:Ŝ>2 A˺mvtIkܫ 'ZiqǓ'*-y~%0z5E9eNCti~\²3=>tQ.Â;6۪O춵[ZxH@g G< W#妦Y> [ՖUŮ8jK\rǞeUI}$2xR(w@`m:j?VeLNA?kNfٰ 3'PYԤlSz?qYԭ"ro6x|cݯ-u븁Rgt~ubDr/Ig4Fa`-襹5ݚgNyd](g[pv}=ǼSwz5DGpNxZƭ>/0̟~MAL ŷ#A}Q_njDH.~Wm L0:+Y; ]fFsuato? P m$4D)\>޻wk 4$80XbYq":>k'uE{u$C7-; }t9h]HS>7 v D Jtiy(] Vզ zNLwWW! cvpmĒ4bQVR3 DAF 9BMMR{atR}3 į#m_`#@-zp%M`JN372B0~EsLw@S*+`dMgP Ȩa H]LbᲕʞflsa.\>wHj_"@ lml'?;s7G?wC%M =tƹaV7ו >aiiS;h*]86EbٯlMΗ1Z T< Qs G1r5ծ(W *N pC'yp;zN _NUMw8v.&l/?Dɉ5zҙt_}ObvE檢=ӊT(^iU&@r qyd4gݚzu4q ɬeO*P=',.>)1XqpC%;Z?E:O8?7uLmk8}>ݺlc]0x ,cpW)akr߱EeЙaC>"]`x7i%7]KO''D[+l0N 6X(UTfIV$F?ͲYumeц.#%a J쇴3uq( w(,_fќz"eS5,l6{[6t3v"ޔiEZR(3_[=|1Ky_g ظ|)o֫+o&K`y$-d(س&0}c^Rd%v}Clm>U)RʲsVZK˝/fŐ~N,-׳d!R^XHz+L#)^njiWTݦ:$b[!V=P8 ܪ_3?O\HB^>FE08+ڡlDe \_xܟEpcsRpB'y1B8'BL@u%H@Z{EIyb2$Ӄn~h~gyo#М3/o"ns rjJ䃀q(R~\edY .ǷxKﹶ/RWVb$ ^ͯ m@DPARvBUOb1SQ}OU9+03B״ΰNwI`}3tW8[x!`03 ~ gțgMsY6|%n%oȅCM4VܮQzv^_ oyw,:f`%EXqhY_?OXOȎJtlͧ48Ύls_mQ"{N#q|;oϋw86} ɣ>tkHSnk,GEސWoo| [mX#= sZ?}/|?(6t{ĸh+jw@+ Dv+0( 5x N6pam'{+ ) y(_+c{es=xa/S>@Tʹ30\Az+oAبD&ԟdqf(Z H?޲Dr:a#?C6ٓ.7vCU_f.I}=0`sk&Jfap_POpHLTu$) [=N\O`+A>Ėz^oWo?3ns2 k`-5?68As>@# Ec=-*a9i=wo7}YyqFĒ*=j~|8ղyH,ce〻9KA-ˆn+[XpdG>.@DQ+26Ww>uFS(a(zdLL$^t?CXC. zM}!puey/Oiu@wEe=$v8w7M+~cǐ W[2;>%}])f94(C%xtk * gdzmV%imT&( ,gB_~^޵餏km+)]1ml7o `$(> *O/6{̽+".&8QN.Kb6ȋiYw ɻjM[>!@ƒPT!0 5O@%b؅s~j/hDI RBaxr܍ 80:蓉pvس~Ηsf!v*JBvc8HaOY2!1S-DPN/a`:>.ӥx~3[asZm-+Eg[0>4AJfC ˰Oa˓uNypD?#W!j"H(فL1/W Q"kޛA z[eg-s)݇W"ÕԾhfؓB&<C*oT~ْ"weγ=F.q<:3ZQ!ͽ"И2[q}2~ OmFICqR_7IE%l\آs;'XdQ'n&@@r l;ٶ;8bau Sh=-)k,SFdv|Ju*.9 4jtIM^wq/ pR[_٣JhYb%78 J$XMY kKƨ\I V/+upZ{O貆ퟣtݱW,BFHN26O-g|)Z]d܏]?Pӝt&p;2нj5<5<^O?I_^ycJHJ\?dz\9mnq[{u^iT>G>1Ocp$ɯf~ZoĢ>t{Ahfk- %% >w%(; #+R3>t ol7 P k}&Wd)@svG{4{߃s[u0פuB-K"Bf#^ $J!u=biQ کVi9 ݝwKS+60{-6kk@-GfTzfXraXwkr75'z.Pju@y\ g›z\ 2-PEY3l1: y׺nn`A:EW.0<;'#n!dbTCXR "R'EY6۽?6ZBd1^7\a,$*!~=9wIh*ڥ2:JXE""LZx%$!Y>9̮#} &(XJ VeW- J鷺>s٢ 8pGY6C]0.A*'yf\ȭB-YuZ{J{XQ&By-($W$&`"lK/Y`M73WC>K#WW=u1mؗK`9I b~xb*r`;kS 0+bNbq?0ޑMXSpkUUsBJt^}fɟ>޺Յز~O c]TqS4S${bzm d+dͪ% _2{1 ->n^$Q92w 4Ӽ@$ MEV&ejݧ4E+H~_>-l^ Ȃd`^DUk':7-zV|ADɻʧvM[U K ~BcDe[Լ0 ڿS 0ZpBSRD+=P"%`@0SAZM+^~Z!+-fE$X&GgsھUh_hqZ~^Z':p ?m%Ak9 ηUB]U0DE\:G]l $1QoL!+!8YpwOws׾޽\i| td֜%si@n/ɩ^6ۈ-[[U@!A |vmfe^P.z:zE+dQR!4$A! ZLԉJLR88ɧkSsFH6[ɇN84$Q_X^9|]m8SNݿ=:ˬ IxG%gy&xM|sHGnUT'7c]6Bt .q܇91ZHʋT!dpBޕ>,юbِ7 ;.AbNUpӖo̥pʒfg~늬 g2QV9صw*;7fl~pe>|;jpq(>3'+ODѸj .[˿~W4櫜;^o[~#1LCq.*p+&"2s#nWLbdu.CqY ۀp)or'tVty֚}0mX[ֹ^Y+9VG{,綸6>$D:UeaB*u(䔀wQp^M6sxZ5}>FtAiWt8#¯\5Ҽ+Ct!oSzO>p ?U)9`VpсXuDr\LLM@ʁW8DN8g|P$EK6nUaR7)RHJ(3)F G1hz#{E֗F DWk E͆Q.(?7!=@@yjBBfr PS^L uuDpծbghE+Yu\ &\83#92 IDX .#Ea٧+Yw*? x4a(2=LR >$ VX+oC1yQ[_nx׆//pH8Zsai볧`03>rK.8 Z.]#|hm\̴\uْI-2uKj$/ `؀Lfq-X7OW;VkCұq1n[Q#y,eZ~e pt.D`So%?U:]d & xZik?n:i.yFdybEf=l?= +\2=n-4ϔ{h剮i7 SNӮZSSCW5⩝T.e) )"Fn2:5)H`èWq`U3e˪!bdL(ٱktss9)ujF UvO$kA/I .Y; 8 ?K81 +.Ň$NGu}}`p_nJҢM^WO OrZsiU:hubD$$T@y;[)1G觗y >0d_;F㱸 . srl!N k7ReO }ŚFW*D:%v ?$ZBࡹEECޏ=;!Ma@E0@7W;r%ѐW%Mh5dNS\fӑkya>9jtIB ,E}3\wd^ӝ= O+QK7e*\ߙzE^p|Ân%"ƈ4(VaehVn\,W9%7Y*j* 6n]֢ea]@jqY]Cʇ"_;;Χ`9p1[8;۵J mNLGn\- 0%e m( ҘRC MTBD)yL!FEQQT̍1TQ ,%QRGBws_{݆={7\M ~¾axIl!=]s"SgCw9/Pi8XܮYјP2RF..Z7o.э%.5t{2$Bsi,@Ľ" aߋy+[}P@Nu9ǺţvsWIGyLL01}{oO}l28АB+xH ?!=nGKQn2p{k؄$H"F @\yT^U@H&.۞/  ۽Kh9[y%BD$ p:=eؚN0  !wsLX񑄁H$!rI &Đ BHH.^^/x8#@#Ed T7]Ŋ0Blj# $ ­~/?=.3W§*A D!@(̊UI#L#꒼@$!P:M^)KB ݷs< >mPW: y1TOö""T=+2R"u}@S+qe]n5/7NKz @Z!By8]sed*C,&_,Qq*z=M=p98F_Vf;{е!!)"bmr5[kD\lmhGB6w©[]k]z1MUk5 {/d2cëkgSo2[]~WFJūj%Ѻ3k,7 *YMBAc􊨄<dؐ_U)mFBIC m KԌD@jj(4~w'_huZ6ֺKxC*.q=ȥsgNߙwiÖG @B՚5Xl] VKF6xg8tgp=Zk5˒&w  Ñv@\~R-2B׼FH:;S1w<0k.j-g^iVA o=:\߂ x-Pvo;C[2ڒ kXx,f6M0Ywi/[WUoy0f$~kWJU]`C'ѯJ۶GOjmPbd>w{9:p}K[L| &i~`mK Jɡ#+d=3ͺ ٠'Z@WZy*u4[12kXd{UY@"pLPN2epN獦А!t*!"s0$t8P&UxKTY&]HXƾ`14tP2j/#pg梪6Tg54J")~ח 4+?ʪg*UIً(UT+ g!+T49a58Alj$/̿vv$!@IҘJFSkv71 Z<9EUPxga;9d&26-Q3aeiUR#e Ru?b=UMKj6$rfyK!pۍ,B_5p]sUVߊ:HX =U huSnK_ogΧxCn?c6<q܊tQ=gڒ i/RaѩX̹%(z' aqR)Z^R'ɢ4J\O>`" {,maeO%;l{ټQxw!6mD4N[ 5M_vW`۩J` WGilv|5u|A*Wo6earsR%Ab(2xp8@4?@O]-RSS\uq4,dΏ 6G;ˮcl>7DŽ-4uv[ׁqul Rv)GCHExn+G?꥚AzvW;}C*H(`HM 킥\J]!dlӊD@ Kj]zH\6C|&8H|(|WE0?6ڍ"Q ם%N9Pӕ̶}mGB,VG=mV¡-wq9znJB0$TYy/K᏶ { e\لǻ) 2lTNdo*$RD*]9V o稄kKZz\:qiKq!cYl۾?lkL> "lID*wj3HB 3fyǂQ+)=WUZ4"QHT `!uף>G P歲]][N2xJXҕkg!T@#, KSUEHX[AjDD$E`ACH{ ҇r؅E^ I(R 󘬭;;bY;:p`IIX=ۋ&7`+:>eIȟOSYKUDA޾ l >_Sae¤ ޴a+Dj2ZVl{O:∶90Jpt+0@zuGȇ,zHjS2xcw,AxExeMO6Tߺ^M]!{{&1yt4tg7[]ro2ȅm뤛cfYcim}xnD~6jOu%~ՑLQShkMq'ga:@DZlad:7Xua5 [g0s? n%Hߦ ?m:0J;:lrH8I<&"(!K)PQ)mNZllGD&Fљ/?9c5Yj0Xzt#'? by[r/$51$SwKQYVdRgt *UU{{8}u,,NlG_!ehy.>[Q,`GrLZ ǰy3Rݜ]'w_=[&l [wVp9ɀfw _d }..%C;)0J$ !k@5M.`B^KᐔJ%)qpWd%ЧAth md=/r0S˻O|K'+ӯ!So=5(XePD`qzzX,%U??<fva&N}f(^9P @y̟^;0bB,o? vu #*DW?k<(ޝݒ. 3Fԋ Ut|G_1VԎZ{o{/^LZ"R&a,g-T?9# lI<%/|4jgw+>1벨Hdd)O6SE$$j >F-(Ln(aB$Dk_#hJišiJvD!OjP)LRMfFĕF$;I^[>JxުĈ! ^(nĴ'>XΐkQ~ޤTUrYUNP A aN ^ۋ'ǷkD10BrEi6YinĎ{nAv2ºn7Ǟ77+;Bj7͊3|?'m1#*4$Y"Y7PxI.tJ0N*d,% ]$R$5Fؗ)a knpJJKB3RPP? LChIHb=!CR8SqC,ݯǪaigTcH% bB,BsRJ0ElJҠcOU0+bT$#GIjc$IG#M*gPq `_a{a7[86Cs(,7܎!u[o:}wE*r H#Q6:~!x(>b2l ==Wا _$iH>}1B2ORr $>mlIq+TN/5*Yj?:E>1pJ\[~nRdp%b,q\x-`BAn" nX*ID)=!jK/XlĢv_' @բD'yhH9ЬB F݇gPb@ v@ Ө7Y`E&)T9o(y%F#[Ip"b_LoOonm'kg?x \ruBEmˣ87Z[g++Kk\[>G &خ$&pÂpt::(}l?f D+F 4rF.'+p5I)r6(t^h nL<Ɏ1@ǀ?~g~?B_ѯ3n̺`/p_߸x4$*> h^#\\Q@6. &dsh :].̸8pTP՝bFFf!]aa#s]E!# WB8,3.k4)e~c.Id!X}10a^ZX|}QZPU@9-,5Y$H^ ]ryi^ڏV^|h` H@XCN7o{{_}m.W)S}z`W'#ٽޗ!qwo,^J\w1'ưXKCh37aU `XPskoL8\:U븋pƼXS/$$uJgUr.-V5+П<u[<ZJY鞮YJ6'9,K&)_`7{X?Z=wyE{`ǒ \ל0ܼŭ'vب$pHTjٽeurKWZ5jtP!!7w>ӆ8,LKe`T_t;StnÖ5p/i -pJFl ~sn%,o%U@# @R}x}ej@/l3}e0:;Hr$1#+ᖅ쿗Jqf/ݻ3`$kP{:H2@yߤ5Ļ;% `'kVI! Bc.ml')}(uRK|y.oW&,ųьD,^w)ZPMnCA0Wg[Gp 4i|Z H{֤WE睵!H\("1ir_ P"gv$u!P譐1F8#Rw\U[;DѤ=6e]Eo0yPHI~A ˣ,>Fm쐢i+J=b~.D(oAI'j9w&{*OZ bp̶(}}cudyk`B$iT]Ĩ6[|~iLY2L\z@8 CCp~*J>C糸6tEH DIGUqO~V)!}k1^C yy(H_b! +AGU4Ds1U%5( &`N"EU͞2b!v֯t)J83}kNqG&_/Ihm<נWfĺv>p`kӽQt̹)D R@;= >^tczX|v]ĈlV幟jJ$!O-"VSX6ljpH[& 2j? hnp,?$U$T&15bB恟r,ZLqZm\xΗ_gQ`9Y5/9)l:j>Rr&vJ,waO?l z@ͣz8T`7$/_f o18v4ns6'lX/zYgam|Wql5j R>^>ĒWEq/^@k}!n.rFűI젒8n;ӵuֱ6uQ`w$5ZK03S+U#.`/a'Ϻ./M@XVBI&Gs /eI,7WY2۷A^,y:П}[12i{beVIy@W xÜS<d1,Qr3L-_=G.bahҸe˸D1 ,gV^ y.Ow>ȏ_pZW*ӫH[W&.k45{5 iǿD@D\(3v@K=zC'WrQeһilKɛ17CZ.88tb=fj R0b(a 73KعU<uȓckc[_:yop}pW)3 ~dd<)q^6#D!!Ӕ+ůSzX;Yϵuf?KQ lc\AhvRCi/ ePKw WK0ZU-o\7/͚Sߥ>u9kv!vmsaLq0I;h#?-흤_|U37m%>է BK7u,0JoGx/zϰǞ*1'Uwi;+b7"pOa/q G9SK$8Qь8'B |^yS,]Q8dpGlέGIK3u  |sՊw1}O#}a$Q'B1.\Lho]3>*l*[,r9''>+po[M tP?4_ *jN<2XrJ2ZLIHq/ql"Eif 1򏰏Ǥ%k{; eܭ!{@vF.~97˗Po'M[Th!H@ꑁmNC)1'JE0!=?e U 2:1_ \< zlws5Qu*!9q5yܺ?NaDA]ŝhv /q-6^Ωd)!IRZt J\E=VQ~ BSZEBmaj] .%>E] RO8,C%b9W_oRs5ѐ>WZz?'!G?Ƿp}F!.qJw3E\N#~U,W =w4J"#ֶ^J8}P/OF>iBL =_vX7N.Mf s㑐oouFn$rr- u%X}UIo)oUplsۃ3:v6bq$ˈ$>ZK!+̸Qqv$尜Dj r,mٴMrɈ|eˊXmrg) |)gztض-E?9Hgfه8kϟ[ps.7epo/-zӀvaIg8jk[fSbF .^4r]{wIHbN:Ցc>%7f!/󤆐9 vHSFaMY%s]{] JZY,0tD &2pa< G p!f)vSnKy!ю)[C+v|+|Y%Z!ZC;U{MaTe%0H>fj  B<rI':ث_+m7Q\kVz0D n#MWaRs[|ou *' }Yo1oR;T]401&$Lp SF! qB-'yն}1ScK|]0ۭ3û s̞vmJ9u4VX|8b0K)5+6cNgv$ߩI-^Pfǀm [JkN ^iF&te?D 99rppUP~]%ejuD0/ɕ~( ’Z[vZRBӜq0pã_G NFHQ+rݱJ/ĪD^SR7@LNn 3m*_ ǔyxVq5;闠X:MُmΘuwxu5H] Hwr7~c\ ܼP0oU?a1lUۖfa`ɲƢ]C9Љĭ kEtf1mX69y #SM'0o` m#0m]v}|&!.H!YvMQ{ms=mIAN ,4oA6y:(Vy&wjJu4L)ߊMm[e{NR'/H;N-r/'z9⧌d˥ E:T֮W{;pFQ*jD] f ID:H8ar=>6@^lm>o>7w^d U'(MY#bcWwHy߂®ju8U6F= rM hi$RXUo !T9 G[X;͡)HYh TBi#QU%a8\3!IaC÷g80TN JVhOU0s}O>[>Y}Qcc%i êrjb;|C0*S*v(\-tw $ywcz:~޿#8Z VD9sR[ IN,䛇.Ht;WZH9?|!ǐ Ԣ /؍p΄ g}2iKvgFD {NcDF%zr2ce?Yfw.r~sQɭN5*+߉G.⎱[X1ǟnɈWr( 1 Igv(] *a^۳J`ّ%Ti捬7tQQDq*MgF(G<\1/ڡ+Ш-zq*GiFM[wcG]ŷ}?Uj/=-2{l/9ڣ9+L"An_1 Ua#O+-ac#{8gU޲`su/lvlg!}vAjo' 1'X3 9W_N?]S?u5uiS<\zzDyޡK\'˲5wfܒ2뽳0Sڒ_s0IڃNô$Qڣ:7C0 1!|(K:1.alCR3q 6 +"%sZjxЈSݨb1{S^VȼtتtԣT Gm.aqEE `tOM+w%17d<+S|J,+E M57Mod{<#BO=JkpىNuvdA>}cQU`\>hHZ YnP\m41.\ς5~t9$0:֩k?4偑k汲;Yi׷Hi3Vǭ9V[/ 53cLMRºVusXkүzu,:uمk| oO_ؠ_M~.D][LiauxتQ'ҕpY\76@pq?]-o9kt~ SlQLN#Ɔ;2sڂJƘˣٞCzΎֺ͑R?Yfp2 89ƀDYD3!$Jϭx>P/kEwZ) @5QDeշ~x²}oP 㭺 0WpTtzFEv.^)DSBHy Gws#3?lٞ@2@<9j\Qe+0=[E![6 RjN^zZд3t~ 7jh{N\!$x|P󹎨ٗ\&rfB|m^5?N@7STѾA8VkR,%g$&64{ ,/'iHo}vO[#/z kM q .&pUTH#"H@*H!ZZ+* (VDRPFA Om$ЄzȥEN"7SPdF8rN?&z >Oy>iμ߇w8ZCCh'6CGk BD$}+=]I]Hbs|;> M s[DuiaAr7uPB7Tt%V~m{4gC_Ċ[^_ Μ^zLs%m6+]F`3*Knnsq hT(g~F\{J3u'J`y2+A+Ql:.SH52tG?Q=<-ZIFiggZpO.z+E(BE`):$Ⱦjƺm^bm[:hd:k2M7C Hp-c? W^g߀aeM~z{MrE:,j6L\2ݮH&*8`nZ#D1I5:M7 U@5of?.bңN[n %^H>Q궝=Ǧ򱴽5 q :f%˳JejCڏ+< C?G*뺋,ٓ`V;3+ y1PJoxV ]ciZlp <ϨiwN{VPn(`ȉDsȝ!JG|rԧŻʉKb{ɅQ}Y w4t/Œ@w-/:9Ufꞟxe0V?K%q.;K WXuwʅ%@4ZX'<xLp 6쒽rz?b<mv#{5]&{ )+`1{ܬ侌HIqU 0\zDTvhh^V1{Ɗ: 5q n'| MEb6?dkHJri.jgӛ@2W f FK+Ŕi 2ڌf$p7BOrCB*AP A!SYyz䅈ئe4_NądT kXTͫCVPzts-䳄{_8‚dv?/l>qY=Fz li0##{$9Õ#Y 8"cBSJS]as ߋK`"XUVtRR67kdB8e;_bZ x @@CLJ? >!,e-t/1u7d1 iz=#{٧u)49Y+oNhzM7MokR_J-PU.?C0C.{Ở\\/9P4tyYK~b$1rB7̪H:fމN`FZ|Κw?J`Cx{qq3?Ls&z!!XW D#[H\sѲhl5ދ'FL4ݱd΃OerLwD5D+W( ۷xhhfPJZ_$( !gq", iYQdc9o*Iqu~Ge.QLA8BA`LM>sD7Q 9t+z Zr4!1pzrbF&"̞gI-Sf"TI'QN#z[&iݰj,(^BߛW1ȸ/8 E^/r ʖ"F2̓y)ߌAɵ*9DŽZ~fkbGeU'Z*i 6@W a @a_In 9tP!u/hcg~weA"q+.Kz!)D@cv,o8ʆ-Xnz23 ]--xp4P8泪ߞ1SgZd6 %v q8⛝I R)3HyĘrތ!L/ pPtgL: ,Л(i]pBDFvSz)vU|2 h `IqKy}J7TᲶ4|h7 DFTGU/LJ"`7ƪa@!9 ڐ k/tDoX)0lmcͷMf@-GṾM@SLC?msR ̻F$p.TGh2+C1&lAcٰ&V[ੑ:mAQseX+ڦU"<Â/Zu­݅8,uD[5)?xu${̾۩`W,N0KRⰽ1؁N\9Sp2@;3U4fh'."npwps;joS__/g[ 6 p3WVi, 5ՂoD=zssoNaydc/̡͑ԥ &̲pUYUc=GzTZ}Գ*;׏8|#0*;4M׊rrZn!HfŶL2~ƢB,=GR~ T~2Tpl@x,[ mSIÉ Jw*'S mN-DžPߪsWƐWD=E~Y8q&%z -Kv,re1!WnDNQս PjcUN3qvEix(n@t {@@a߂FYePo̒bh0O=5; ipȷeI_PA8Eqcήlb{`==-d !19o^vRLC4ޟߚ4%`N3rek:|G=Fc(/_Va]LƊdqm?#>Ң_՘YKg"Qnpw¿1=q)%{E n=޶Ub~bŊ vV\><:GF6q M#p:F.ܦǶN TK\6 ϊxks=َr0yyIzw8x0`k=n  95bs$E]znCDBwbXۊe)b>6LИN#1'Q+ ^UN2$E1kҢlyjB^pS﨣n;20Qb1]u9G2&{?.Rpzzɮ;c}3@o]&\x^=Ύ͊gbJ,#q'g%݇СhćQtr3VU0 6 2 i ֗ۈR)'׾$.4.zZϘ1/ؐQk^wQ(PDzF.@Biwۢ(=&vM,ڒBTfSw)1?Ž@e(,j 83Q829[ݘ*ܼegQ&Z=>{ͮ9q\[ "0]z-"~9f}؀hS#Hv+樎Us:NnJ$;|8MGɩD 唅 R тCN%s} ?Z?NN62GJ+FX EBj7Of/B㐀amI6,o,g+:bVcv[[s^^;U NΕ J^}WU1?P_ %)+C$%{~%,K\Afɵ KP FxڱvY]yM.6Re0PѶE+&;ՖxOʁZ3k|0 ~l(W]hĺY2dq ÛjDמZ5g#SɯM.a Ͼ)º]9㬃^u(Kyi3oeC:Sקa Y+w)Mr|bvlZ{<6bv]:%Fڱ-O Kt2 qp^Ž337+sۍlOuogOG;L6;sJh%9XjtuU}D {=g7 -jd4~k#lB[:\y.QdllQ묘2>@?ko轷A0>e'49j8OEdjcEzomusrqn(>mn2hxe|hVb )ۻ)&A|Ң&[.Uy֘uvYZA"¬FQ*xnOE7ȡ1! 7'q4($&ovj)!8EQQs#f ԷM܀"PwĢ٦z'OU5[edStZ, QK"ؕ*aV Zz;xr,  /Ҏ gl1TB;ݓ$P6u6~_73Nf+]~"4װQBAS*wՠ8!@P%STЊ S-kvz5[ rz|ktwq|jNnQ18) `EE/jݞp?"s#scp SVºrxH {\'jjw=ª=CA>~io`>f'gWAW +o<~|j\t,sukIS"CӖ=ʐw$vO5!cK<^5f FZ 2\Q?pKImUr`2H9+Wj_IJlI7]Ҧ[a(@8+Jl ӜݦsF-%@X9Fz9ܒcNM0~_sؿynڒ&Edx"9B^lVdA}t1#&'}C^{\`Q:NB&29e8j yn^Wci(MgT8U;d$$35pgMƠD'[S?xN'=]J@T[d9t~WE_0`;kY]9>%h7gqmiVN"a1SX7?axo_eq pA_NߊY8qDsw0 %0DL֥p]'L69P>&gw="YWo=^p?d]lt<,IA"L8GsbG""QbIz޻X,Chpi6uZBV@\=/{w?UluD%O.dy>\Ѹ L2S^Aq_x_ԧj8b9gIw+`b#8& $H%vd ŠOҭw [\ޢ(:!I\bZ%_No<;.NL.NJkDjZ-Xo_%|cM/<%40&4.>BFpyFTuwɻx=,O[U߻n6{uEŋ4V<%" <=qw^x0ķ5u1!©,5l3ރUF鋽WHk#۷=> lW~]E^g{;JK8)?:>igmӷ1>%k-򗊓hsI};wB:88m#1vp4ѕRZ2!ȲX`0D,)@?jR#a&5e 9n rPGt2xE?bĽR>)Jxo} 4"j_efHt4}z21;, Fh5PN^ rLj8$@WIE}* @6]}g)Ä@C 6H1v^[yx?O'TVr3*gѣ @8 4}9nDoOh_>K>rl[XYýX2H,foT+c=|t(󭫊 &>\{g ݔ{^X$P m%c ?+,J'kavCz3uEAH088p5sO=; NVbțJvِo|a܁r*DjK]19-ՙQc&ZքhjtG<~U`L${4%9&hx8J?x1_ۧ4`q0qTZ:YrE_`p^]~l0½ Zwn CxPieP${{^:YYnjtsdYp,ёПnfj6Г=]1Da=іj/4y^u'^7:wiVO"Oݻ+YHb?MiuY@]˂bnuNAr5xd}iJ3p6?dsL+f{&:L%^/eMht%C#cz}6qq1GLeϔ~uvGe:I _X89Y?&WkґaZ-Ȥ*G#:+ZaY&):U BZ,n ֑ VRkv4[St `T13HhPtbG3&'`1t!Z˖u3 _|)9B˸{owo?k=ZDX;@E?>;i;mܗ4(C,r9U'Q;5aI k!z#ПGNA3siJ`H+3h%_wTv#Qv| }˹G 2HH/D]<݀עdhrx;214D8Rk^oJuFb=S1)$;rcB1rx~sг0탽M+l γHN)x0F"@&Mo]zy,Fޝ{ DVzXt;,*ӯg~K]X,+O~1cEqy9\/:z* Bb֮\آw%F0xS-0ZY[5>ֶuGurt% v]smA^+Xa .iX"_udQef~(~#oe /I/oF+--L/[] 6@:VJ^,*9"xHOWt*U.f7|Bo߽OZ=F#75x(b()?h^΍ = R_%YYZ4mʔ]i.y fy3+sŽ#QhQZ("SC:xھ\a{O4\>7Z[Աs=襠EjVxsJNfC]Lken BvЪvfFGdC˓) Ғ$QK>X#N~}oOMa5~G 2 CdKt¬vQ9Wy;Æz"YqحW^J+atcCD Ӧ8zUQԖWmuMYy{?5V-!IFm83E$GSwH4H5򺽌 0(`W-L9%sƏeY[?.^ ]A =o(|vkX^VR6bO]s74 dZ18T @DI `( 8mX) x\iX-*^jF)E-W+ʚ cJR 5IOڡ1 H6(7uz:;q:r&P濹_vheͧx9:Hdꥫr_DŻUD TEYyf;*Lh3ǎW"?~fU~d O2Y>ӄIԓ*g,TVܚCvo~/Z^d(9x Rݑs Q j7ѝq@iFhY8L 4(Y%LRIqu'tnMZ@BQ@0s2A5JT-HiٷZ sNvEwa2 Ͳ'naY 1ƒXݼr܍Wsx4.z!t=쿪7+u\mgsEDsGmiRz]V+8;,1zn\ԹR]^VQ>kvxmseM#6`Sy<'_(%q*7UklOoPWOn/ynmtRW4 ;{f_ YX-#-{IWm&;7b%`0a?P|omAN4%{Zv{*ƇwF|lĐ$L1$շuG86IS r`>윋"c-7OiUcd ]|H` Ԯ;*T4t)pB!B Vb,R(z5a@y.FYh# xF hc#WXUSg8WF&¹T3^ <Y@ъ\4`[>[0NVZ5<m.60k{M@ 8"{֮8iy:2EF4IRi*¢D՚?93,$ùi߿VhҸ=%~E>?/ ~X[f'-yua3j [~t>=S}*_w Gu'r\W2=:JLNHQy1 2 * fL O"x p'kZh!+=V Nn$/ \em좠Olˆ {%C-bHc}}Vˏ2JgN;o>yjnrnz\㶪B`O3r-` ᳉B6ʙ9~Аp[%BhV֯"=bVv3`8]C G.AOij5Lr6-sWQsyJ(p_!DKD(YQL)C l?G~FE>t} 7k$JdC'c CdBO,d*Iܠ5Zf)K#cFԎL+65PX@Y՚>\Sǹ$@ֆFB$Ԫ˩Ju~rv*MsNs:0L Iq|?O"#tB l @,$Nbr|Nd PBG j=CiJ ' q 1U-GG=g"F WR-4RbY)ܺ {MG`H&ldv0 4H!:]yf3QUPR=+6&|¾N\]{jz</Zbm(@N@UDcd'" @%| hd|ͮ4dO*mIq9m  +[cFo9{ɉS ML0`BGf^-iΫiM=nlMUom=L0]16 U_| ~ šo(XQ\>enP|.WGޖ́=OVi :O%u&飊ߗ0BkIhb9GLAJ_"v ,-I+}F`!`)|x W#SGk>ر=$9{ߤn1^V[۲lZLj7?C>r2KlJ+ (c=q7>SE6d _5.1 b/(I ZK]oʲްʈΡQkUx-ь2Gq8K5TChj+k"] 7D@@RDPP$@F@! ⹥DV0A`̀X]*Oe5wXrw PюYmutde K8F-.IQQز\!&8x xov5ѻ&vqX3,'hdD`fS Y~!R1ńT h_ob`3ŊDG; (d>['zuWEsܿ@$UŵV&7.oZfز^kgy4c DڶyeD%`-ң ͺW6,u|Q*G41M\,j!a"x\Ƚ;zWZϳ'b|$ 5 -c`KsB2HsB 0/Ek6Pa!} yO<xxp  8i*!ﷷgB]z۳% =cĺ+JBTglՒ1 >g48S8B/?T?b Zq~mraNbczΥy<Bz,k{tP:vuOay{`RfY+_Kc9^05gz37`JI!y[u'$Mxc1,~RB<ǕxauR 8XqJ@9)Y,Vρp~Ƨn أBr1¤TPq?SDx܈G'eGO9BT0#Z?xr#)UaV3VdQQTL5P49e~n" &=ĥq#8kgjijxY^LR"ɽ?`\51a dQi@7Bg7ct1mKwj|ړ5"C:-<_e1':$ ;Tn;AXEZ 0UPZ E=q:}ӻT@P}kuiۢzR2 C5)γ+U$#Je*% K Δq/0Nh21 (׆PQm96`g8Sw>p&V5C.fd$,RDo`¶ 7iba+H bGLI$/!mI /oIgnpJdwF!{? 'Ϫ*M1 RYزt;;6־;m4! dt H DqOT#YX~4 ">0ijtDHS|T|2&]UtȒ?@ c!$-O)qE׊.4~E҃;bLQ]itU',)9z;=S DmZ|_*1L> FF|d2㋌*P [f!tڗ)ag>9(^~~o(H l: VZjh/Ƴ&g3 Ip:*_Nj'qzm%q][vQlx&-T/XYĤ*yO 7ߞuɎA(‚w8f')\TDZc_mKfe 훤׳A AKYTKC_;ie< nax*o 1vHnvfr嶻+*3"9 ki|WL.'>q |"zM9 \P܆5 ̵r);Lf4-$hGIյ=7nzI3R`^(jXz/V>mzl-!H4hz oDسVM^;l۶Z5]kk+]4[v[ qu\y˱ 0"r] u|Ci 14z?Kut73}x/ku F '8g4S'okuPmTkҙdI$jl#GrUCP@v}O=9 򲃐yټ_e2/#HA{m\nOU?.n"$Aiɦ0CߟS.Hc$ 2vDw.g#\Q\c`SLWs_1+j{j*$l<s$3Jś76Dc U&'18@N)? h5!}GH/y!E@9U@RsϤByXH-z|LEP,Q`,rIId@X,6%Hޑ\Y"Ok_*֛~ZP0$!5h kI뚡P1AI[֮\,h~ &Rp& O|̖X ]MEM'׮KCj Z&!ZJR6Z˦5̠~^a[V •(4K>y`r닌c d~ Z9sS[:u6V%HDaĠ*"ukPFoΜWR[)+xEHk,৘ؠ_#AszA_8bWRlF8 ips cdY*!WJ0P`S/'U<.Th95˜8;ڲϳ7|->VD ~h>aVx7 }Ӿ\Ήܞr)E?:e{& L|кI0R3{i*V.>܌]N7t6$2`e}8Rf@ OhrƱ}(#=Nw_usbw~/_:KY# n46Ȫ2v'Ǿ4E'S~fcpYq3LS]>s9tE ( ']eS}Ʉ&w0Vl t.gJX|d_jD"e7D{Ɋ(孜 BX{1J3$ٽpF(FW E8Ikk])Ͱ/VӦ>iҧIFLɭTViLH\2I!k^ژ_پmw/o1S5{]sq{)@{i]ip>Q;V^LE\(Bg!\+E ZT;Ǿ۷s'7FS pQv2"Ma/I ۉ h{xJ XCLCY573Bq(.lSO-L{Ngބ\f7^a"GQ(C`11yCU.lt4S ;_ Mu!f?HR%.݂P`GWszvNb43܄KN@ 4 CpXh"S8T /h#iD׿ܲ*3'7kmdbtV ޖ!hŠƴ|Q ={pA#. v'i0CEޛصK%{sJ!8jj(9BfG^~nnX_xpIEaWhzsHp5,'qNHuRrpӧ_vtLq.[G߈U@l@0LjnT]&NJ銲iHK BXډaa,O]$\5|ͩDUqB]|? x|ܕw/͡0uePjoceUƭh|9v"'g6$jS t%A$xwЬ,?ZJ2 ΉZ!ğ|=Մ  1k: @S9 nHQ.;e9CAqJ9*T!um[ΆVn8ӟuKսw5A-9ɛٚYis *}<[!-,Ҩ([D+84!:kV)LvoɁ`TnlS[V⦤3R`a3p:`'y3lCul9RFzd, @ k%Ήr_ļ5c2_X7ҳ`ic2{x^*tԴŇsNT\o{3fIk:ͯL^yĜV9|B3>ů0j- fۮymvm׸2kD=R+)9E Ա-hY0oB#'R@poYb_PqCophtP,oz)JˉcL︴Z7 .ikSފ^ }*{MZ/$hRqȨ zeքQ>3 = ُKiՊ0 k@.Ϻaa8z+;ZE^V4`'Dr?HIg9fE|ǔ@^9}Jl␄A~W Z s{Kzh_9B>pEmֳnPt_X@T idf*"k*DFI@Wkp7i_vs.d&̝.lY<;(ܔ{6X$]3rګ)h3ԡiΌ4aIa?_Ҧ϶⺘Xd`2n57ʲa+bc>gPPErAco~)*gZY3-,X׹Yj呵I0Koӱ0TyF".6. -tSt`7NԮËDG&)DW5 з!RoM F$/iۈ-̋4yw|{= \M;27EU[怨"E1ˈe@0n#9 `rxsb.\3_!b.`8WS51B!,+߄ V&1j!*u3Ww6.Ƈ~LᛩC TK4_Z 0 E^:љ}A-gD Ρ~M[xZ!4~QA]U s_>+R))κ|LdlaGpuy1lW DŅp7/@c!1ٶ9؜3mFO⡢4@EZBCDOAZ[IRb;e)Ξ)bzZ*◬N &o0?lˈO!#pȇLLNE/zTGX؆08O :TDLagaqx<*NywLFDxIRdz|uE=;{gih[d i PLy(XT,K`A-€hx` eǩG4!BkѿgK1vJ0v83>ćXU)T i?Ro@Lʮ!("KWfUfTjH!͠B(Aa\oL*+˷&Fi"y_Z6UIs!P4wTh!Cmy'k۠?[ztB-sܤYI6!_\!HV;Riң-Mu(71y;JE$ !u9g7vZXZ*jqv9$] 5BS-/\. FƮL;b#3CtLz# ZƋlE>\\~g n֪Q,8PZ1`x&%]KͨlQhYCMw)PuRL=V0 |іZ'9lj6s@o63,Z,&>6'Vr~=z>u0:sJѱ^&}i>\'⺙Nw!mUt@%T{sYM?~F3C^_6NF3ESLge8rBx^ϑ" %dӏh.n=?!In/\|I$ ɥ1vҡo~偰vNtJ)/HzrXt8'ȏoU{;m~BK>쵫h"&D1H1#6%KuK:$*mYLplY&U2ك,{aݴֿQ3&(#tBYf8-У${]Mzy} e "+e!Iy"vJ|؀MV}L:'Wo8~bnRH^9BZn ^G}ՐX!/Apx PS<;It14 `d@1>ww:_}k9^eǙ%Áh )0/(b快诳~m{oC>a&HwK=>^XˊYs*.5yC HB@a-CC߼~r@+R.6}s"B-Q†o/; ^*_ٶT;mҡii( PTF_q6zkM[د$o8>ek  Si'* ȼJ* j5;ֲy!|Tq ɻ:ϒ1XkG"}*I=CSz8IA2駞dFWM8Z>ϫv~`ߝwd +#OMvNJX+wޮ+\U9࿢X>'yZbMviqG<%^cy0~ewd}]y$DJpv&}7L| $ ۽o ,!*rF%K ךs=]\qX${FM2Ct rOψ!^&IDeDF~jr}dNDo Ys0WRI QQiG}U@q[#i@}R16ٜ>ceZo!|[{Aj_Yiy>?1!9yNrBqtz>5yz 1 h{o_ּd6?Wy/^7l+a?b ^p@QRJ@@  3.v@>֥E!Dgt0'VEmz{m畻=BpĬOlO';HBIHS|@IOп%vN =򥌱R?xBra!2^9 Np? J-@?b:L օ]h G|8X?x~IEˢKـ?;n ) l |HՉYъ%TC(@W2RܶU+b@I-x;V:Џk,Ks&}/a\%5u<2hdE7u:0V\vn ν IOBY+]m`5[HI8ɮ)(EXQφXA IL џP'PgGdT-æh8Ʋ}E[p?L~)N.\+6bqq -q;qݕi!~ :K+h<",upS8 HLTcR%!ru5O8~0 b4eBη]|g,cI;e!њm=g;]ɫ{I xX6pAVwlh8ՓƑbSNSw9T}7Ӑ6}dAKEa-˴Т'ТLHD \BaHzJ ?wߕ\IIpH#w"UWϸL&P6 }'JUN\ϒ,Vn#dyޭ.ܿvk8?` ذG2>z70',w/+{[mC>q7] !_`tu)5cCxi 俾#:ymWw0*&:Y<%,?1 bws}- X=}BqWDW0GUd)9ç"-Le?6O$vb0yvQt_hfDf_f`U-dہ@.0'9ؠD*1fj`K O2D*X*-JuiD"Ȉ\35Ke!ѳڶ {YJ`MH貾lPP*⩻dk}w`l7'f7ba=/o_6|Rl8xGu& k(Br|uJ<޴KzAbf:Ύ'fh')`uV.~5?s}ݝ' 7!vVv`nz39' P1C4]85L~wߊfew7/dśg}/*]ga%ggu!eJxpǓMϥŏQ4B;4"}#L o(uD:1Y}2m˪)..aK픔I:,Rفpz IDEp4D,8`g?7hp__!֊΁{_>"ì'Q/uA" N"u߫KxI{]8oa7ew{:HRM&M0RX:dB ˇpjr65\ރ8RH@4 WF)dA>!L.fk OCIhb6p>>n*nJA{kblq5C qU1AÅ I tq{ӑǡ-=Nzjo6#q*s֏/}:0CJ8Rpe&U$(ư֤_!@ǽ!dl~J1c Grъ2VR Ac߈B)&$aO(#2>#`zM)Q+-ڤ˗9;Os)m+6(/;t&x,Gg} ֝}%63(Jf6I|jԐِ7@4o.Ғ 1c8VÁHn߉vܫCF'y$)ԟy\kA|Mg"^$дI vB͞Q"M>HsӍJB0KaU= I GbÓ<0ϻS%}z7l.-2m^!UU{?EXoy=<_pr2< ۘj7,@yɍ?tbObUqvD=[ҚmM6jAU@vS֧s7I<1Nn:\]+1'0>J%T cN`dŜ D 4V@it1>M旆woɤ fZ?; j,9??:?އad 3_V$8ݚ'r۶L(@G>o{.>^۹1)fcR>g0nMr׾}ʼ@G+< lv؍|)*)H!F Ɲ|CN 5qe0RI;tҺ) t^>,TR6 AUa_Yڳ+xBYShÈlppBv@. _WZ'PY$F(BgnU{ Ǯ ]R7.b9|f})kI+nڞ 9F"_H,F gqsJ#wpQWSZ5S%ŋ>#vM\PPh>cs̯.E6 HB?bų}O{gX|&v]AhʙS&&" EkQFb#i ̊-gǟNޗ&կE]p~o|=ֽxձE5?v`>O;K|,>v', @ -hCQQcbԟF#zN?m|(5 ϨK_1ú7װOEa_7zܐA.Mw{n#P@pTaizG*\19@(xp.$A Hs$Mra2ƀ;0ˈWP MTzyXA-[M}]H #SU}ߓ2@|I׼ &b'x&[LB5bR2HJE9/`;N}OYP[>9~u;| dQFYᗚ|ɮ^|tFnwǠsIfПvZ~yj Iltߋ2&nyUjۛ~r?g5b"q9Nn! ސ"j~R> ?:Fkˣ}5u:Gۚnq,fn!t=z-SQaKji\ߒ{@'AHeɃ9Bqzy c5+xujQF|ߎ0"Wv)ǭ.CMsHMI7_#S~(\?wB_XG >1[ׂv540k~9j~iXr(\M 2%\˻-AVqYm#6o3Hhs_EMI8og7R6hqDŽ+A~< i%9wSG.`4"+=N8nv_'6z1@]cѺazf Uh @pA(uى,HLKc]NGL7n?@0QBI "z(sGH)RC]*F}߅, u9 N2[>oⅠu-ɸg܎V4"gT&WYHWf寡W+`#c؞ʟcoxҷ#~~ے%Α<{OG$>ԄRR?A ِ^!@>|zϓG{T˗wv/_E4,ABe8LqnMM^R8v\䵫!QbԖPV>g߆Uh0dW]|z}@$/g\ L Yl[M<:`^[A_,CM6\0 FAVHqހ&Ehwz5>kPp&D'0'X*QGoYMu} ^/׾(_ 8ɓdlf,h;S6ow <[b%oNVr~Env^쮞c+EJ!Z ?i#t;H v ʜ {>,9=\ d1)zC\)UJMk֟tS(JnqdsA-TKz [ê'=Lt6+c῍LC*߄-{O/+&> Kw؞?{|˒D$tiq<Ɉ`~!#̈?=>G'}+Ãpp*8ĖS 2E2P'ΚѩC@PZ}|w| 0 FaΦx#/Eԍr&x.BuŒ/!Ʃs/?`8_ F{uJ͞dEˌeW2=60!:F cfVꊉbڕt*` %A=d\,8.0[hE"nd W%?wC@@!N0Ri ,Aj:')ؿQ/8{-;@Woٛujj6_p3hxwBӑ#7 z Mp ؒ^X̢Rήڮ"֩YK=<5v%-<Q>px`oyghGC7zoY$@ ?"pSZQg\S4|t<Ú5{`  .XpQ8P+D?nr1zk=}f nm~"E2 A<5)){$@Vd|{&ld)P7sP qyk~ Sĵ/sQD$Q"X,8Pşs+} i27G,4m@W7u]~rUO`{d7gfTEӕ6nDi<6 'wz`JE퇓o-61`.X^k'I2|GYX6C틤 5WwJB}ajq׽Ȟ YTء<2$Y j_ȣXY -xhjaB=>"P 41)Taɝ/ߙW-avGC22J,eo7@-Hkzܿ╳vKx[Ts%‰4 +]uW[&f{S/(h=&>i?o՗&W .3 o[q:L{}0"tq/g!SG.,OO`0' 9h74R% ?A@Tb6 isn _z Swѯd#eW%f\Xg`Ж52כVDoᵀ@Mt}حS!1QY:Q+%b8 U-@1B u1Ys@B\ (wNB7.§E>%v QlAJ*[آv#B^pZ9lh"(24XNf+I=cS5ug/#xF&,H.4v-OKRK鰱 "Ȕu#" nm#'Nv{8t%ų,-Ũeؚ9Vs)i{D)ici~ .EN%54 &E^(\+vj:RH6,mͣ* pMg4æYTGz?CmqfWB›=fc]+c 5E|M/!Ka,T {fh`#x!q&v3M5+:E<.c䮷Ľ69 d5Rp5F _/OG!~ŏH3>- " Y,ٚ,7͘kHM{O5p1(:ٞH橴Yf'S˳S;ʝ9>lSa=wii)HzQN0%+_dV@S-Ň紾ԥm{]l.;hVS|Zٴ 졦7z*1187Vf֊YEG b Stoy3%f!WD@6I.|׼@?yoٳGla[Z%@aak1$)p@(؁yf' >UJ[L`)㚫¾h^}ھ:пP)!<^9xgtgt(*\QY1%dz&91rLafgHQABbPIGA&&}./[Aa1UMtW0ޜX0&B'KNS "RT\Gp;:VL8GwxP_S^fR`fP'c 4Vj+Yiֿj:="eREp4׸DFvFYCPe MR $ =:Ek9/<^ Gww<$`D#jz,- ÐU򖚣&@a6cghTg梃>L//z@th%T 夂+ b'f:}aN  !9/dXz>:q4Do4~O}G*h yJ쓯 |87M؟!L?d!xf<,pyiK:CԲ|:M7j+=gm9#?ZfQ B#7yXР[$ӿA?d$"PĹ1~"@TOM__}s毤#W]E\/Ocz/[z|ܐMbBU`rb 7r8띸b>5xSAif9Ąw9u0l>!+t6웆/eÝ)`lx$WNl鳐2M[ `nV[g?KUtodA)IB/7Y *ogHPb{ m3RhD =<f3*{W(&*ʝD8l VހA#+J BB-c͛]^TU9> D}}Rm?˴+{YhHq$ g$N # qy?˔V$ {s*ۈ" M3}!߀=su.}وǖy[!m.Y(ҳݫ!mF [B$ /2,b>O ]P 7r$!B# ƬgZ30A@5 -7 x5($$m,Mϔ=1T޳5lN=`;C@,D@I ]I=(^|~)m=F "5XXĜi dp晓 5mlhunF!D]h n;L3,`b-;lg|Ydݟsyw_۪~oiKOSEF`r&B$rdhaNŏ*Ǔ-v} KLM, حzf)xB~ § y"Ɓ.ۖ^" kC{x)_x!=zF p :@181kO7qa|x}`]'1"^~6?l57|6jqV)/ $^EB UIDžIJ,&J^B:6~)iB'\L08+7NĴI%z`]B&>s* )r%VXc4t'FaTz{G\w@;IX3'}Y d+g_⽒ '_}q:eҥy9'~Zs p~D8.Mr|N Nv&-Y@Mكy䐟/i9ۮbA[{˘W#$D$Q*[22ރQ ! ~>,Xo84 Wmjwv؁ޛ^v̓ r˞?p];œ-Y?:dql5/>i㤮y?OmD`jwˢWmdj7: Q 08?7ui|Ч+HЯ%yOxKAQ ~c#)ܓQBa' "Ƈ}$on8G[xo$Uop}t}!*5yeێWL cD9I?}v4\>ZŌiRq7h8[,/9Sݵ6E(341i0\C_c ÑDdgOaf?҈8< p}? 2#rhjP:KoG1`P$[F'}A϶cMbrwe rT~fWW1YzA(KhRcͲEO&T:'&J\KzKeAN(UWdۿ۪lH ϵ{[rl0<ñfŰist"[|%כkXo.aDyT7Cb`:Vh>uQ!㒱kvn|Y}̊f/ӽʏLdxS  O;ZL@x&"BNM־J1(7Nj[CSb 1_]X7 k ^T޾ Na0c*u]VZ6?~eYu)4Rˌ\ԬJ,yv#Lto;AJ&'XcdS{7:5 RNHQ!cp^='U^5M6ڏ/wtKUI*k, Y}2p(8vFKǤS~fvj8ѽnx7(q8#Jnp&j}߇Tiٗv>U d*^7rl67l4T/4TV~ a t KjQZ<^_緒ٺNz.~[jaBLKs򶹑=U{'>Ώd̨[Q;4C O{t.-_ts+TK ̞ۇJTwZi0yg~ YIqNJ*d kvJ| 9iɂ^ .ԏX/1q 5pD;Z`r$&O;|Mz6l,sBV@BP[Yqp0GR2|F:7pyYuפ(`Ĕ[ɁA{݈ 2^??N_ˇ\Qt B Ru ~uPsPUGxj=0;UV#gbp*4M;/& aݧۯ^ 36aY{lN6U?a >{:(bO1; w(o/ IMCi=#qnneҶdx Kٞf뒣pҹؕ#L4cnɡ]CURV:GԎbB\˩;W;ׂJgG.`=UmhUv\^_MM ġ<=vR QZnޣnKgP!xP$`kH}_JVۀ_W W[%6F-!6xXi*r̥'32\k2>TCA=ގy^mR ņI?G'Sh nOm 9}=% ШdM(ĩ)D䗭o~=;oK| o\ŨUA. `Q)"!#dl a#jܘQɌ':[?t`.EuZ+gkI]uWS6n=fTq;mfm"}F۟!7`OnF#Tz7s Wv3oD/s󷅴mHޠQKq#2+adSE~eEpW֣7zκŎ(L$r[5~~sjn?౸ּ] 'ۆ',Uyx7gVUQdkA%Ҭ2. *B~BG5dֽfFc:QS9jix(g+!Q[6:+Iؠ91EL.rPrAoR*VY榽tȁ! 9!GuQ,KhM O_y٨Pnٝ(L*/ny;!+"~[O1cC q,M¡TeA l1M<% iҜnoי! }1m4) ; pqC;D{/V'kR|.SJXÒwY L(YCmw^ҙ:G@bCNHF_5y}n=CUbB6o|4 /(ƞT[I$Rҁȁ K 7`V3ɠXtdC6)3V&S*.`-O(rros6\]8COj Ҥh. *n΅:Iu^ڇLȎwKn0I',jeMUNOyYcڞ{sԛ7bvU{T''cEQZh~W|Gt6;!ҙ*ۋ uM~Ӆ6NF"b;:?O}DwױOCJ;`{#CK %1p0}֧!i;r!4E/2E84ikX^iN0.L4I|F/QTPkuy-#h 1<_>v*j:,{m1R7]nۣ;@65H}Vyޮ62%f/7dںUvyLNķ:){jY'1%DZE !lUdI <%ڢ Z# k+>X ':S^]YH,2#PE,݌wm~G6WЂ@""M(ua\9,3N%t Nh6 I.o!*Y٦$;h8CrKγ] yI 5 5\:qCCsYNC?-n!{hAϐdJ{9s9C&oXӶ{lH GZ #h6*$O<)vfôZ0>vLJmfk|6OF7lz-4%.!JN5˨"[iFH^Amc`cAbݓ9xxv k+M0{#,6J0*<#RΩH6Zԉ _x< $>&\-Vז:0虅à"KmZE pҸ{6ޚzpZ彚6gի2JtzR|\AVLIDPDT̊%Ntu(tQ )^>t EfHer~s <\;IFGJaVY໴iZsau:f"]=@mvyD@H1:-ldѹu3|߲1 Jfu =) j$`~Whj7{oe4Xi+d? 8NۂFpG㦈 Z*B|PPNr,yV&'y t B @.m+b2`KxD#7);g{=Ub\,芥V&Mi5DrcPRIB%؞yn^Y@a SL'qTCcbY]3#[6=#HƴrfWmrbzDe SdCABy.MDX7 a2Vcq}cfAJוGG[~~o޿2A ϫOV`CRNlc&q05.kFQ ox'?Nn[&\c~SQs: Ѹsn$4?͊0 =dZyAڽGSmx=bam7uQ4wuYEy'_m"¦dp@8 Y(;Ȑ'Q1z)~p܋紴^z m,ե䉶1S[^[wļV, rHصk 0@zUm_[ǬUXONnm^Vɩouiޛ.K9;8o;Ï\_\zW;kGO<ܶ[m]W]7.mCAESQ}F?ets[6ԵPuGW.T)d,ڕy+BG.wL>1Kz3 _Jb鮬19.nv1CN7PG*Uj %xyM̛dFWb>k}Б[@f>lѵ(koEO|~,y]S]AY6Th/d]+' Dg2>+2R+zBLvJXN1[^ɻXMݳȖHNN[jj, wԖ@!?e-z b7i{ؾ=073vT (/<ٽQ}(u/:Ozۢ=*$k1fXIђ&3{Ue-Oleh:N#T媏"2Gyvdvj x{aw@f\^dݲ$2Δ| 2qKJl~G{۶/Aٸ]R {}7ϻHqm:O6w|[|rpԗYgwEr|Foe(βL8<K31tC\5x =b ;}F/#'0B.c9ZPB-So^п M.S}q1W',#0ټ/}d6'kx@R*h7խF;8qZGMb+,'?xLbdLzC{]q0@DjG JL~cd2|H|uf<_yt{=._g9bdU2٢i|zjr{zNw?'f˧SE(q 2'=}|ٴ¦iB8qC"L=h3@#58$? ƾ ;ŅqiUGBx8rYgDC7築Muxr/$TX¬ۥǨ)忿;Ip]FWFhQ7(•au0j1Bi4gI<0EnjHH~ͨ>=_缯Hoylo]02 6lYA"LNn{ƚa34qZ Wt_SaۨV }:v|o\|"M%a8:nf3͙"фWҰ4oz\|%k7Qq:꼅MWy'e;Q'cOF_ bOj}?ؠtFxa0y<uu|56 ڽ;ʿ[u;k&Bn,l;C%6%03,<!4S^#t>JSAPD.Cid bCzoRB良`P@D!A;<|FssٝXv7NU%yᇋ<Z(B"m˙Sۑdoj`~evJi ΊTF??>-UPܵ*#/ݸ&yd>cE7`d],#&L `Y==ÔG<W JOc*JZ/:|<k>GrWkPi ?:Ը"U|qi/JiLi$=%>7Nk/_W;I}Sc 2 ؒY iRh.ӢyAj=~C.PF]:u7[K@)mYmk4(7LbBsӗ~QзiUZ˚{yIO }O%9W"uآohr64 gޚ ٺr[?"ɨKOT"W.y/|O^߀41U_}%z=Ǟ)2l>fB"qÚg||FPOO@UeO@ӣg<;?+?Ae6%zTyBRA)) L;RE?>s~4?'Ş=ޏ=붗$! q 9_>"'x{?DӱxD.4rStQyK- 2'oh\~$% t T`*aE&A&)K0`d@x a"3/;NNЅ),}l0_ZBzbX |p <\oiǂIrPRUP `Ɉب4¬"bE O~p;ҳ=5b |Vfܛb4whA{/F8s aՎVnr:xbS.=ZJI&M?لfq6G §z' vAO q^K,XHB* -WoֿL͗P,}=˝217)d1uWC7k$yta\~pN1[D>vs`~Rn|g'YEAU<7#/~9LRBZsB3=|Cc$jxq_һ%1[ݽıθP|E^LJ-mO[it(O踄~AersQ16&2\W6>? |2.DEQC$T,IG~&yS#*%9l(;5S͑-lMN\"e$[Y?<ڠU\+gbx,6 2m%PIoܫj~׉en>Ī (T+z 6qLAkی˪;vE[@g2&䮨Q̆ٛ[pӹb!1܊xk#G7]4|Mp8Α8DnW6Q vi>ʵ#{~{PxoBHάh1ޮ0227-?!VwQzMJƟ'_C, YWL {欋Gt^C#!@؇08Ҍ*F+eVСo)d8ε- ;tNdGE!.rا& cRY.K+g' 6qD0n7 rH7#-ܡD7/_9|uKa(+.:_Ϭq;pHxk;qQׄ!qt1Q_й87}{pNnf_=8^v'wpH@"gK=1th}3xUjCNOs00'TIrz В +GX)~}zr X]<8$WEf5O _tڹJ pS 'kfw7b1FQڹ侻zO($D@2S8pz^~t드?g~۹6]"۾}w!Jf1ϐ~p)|R7TN8sA=1|[/3I1H0g|H3WAZR[xM0`K>72[+XRZS`$zqirsrdY&4T$Dvˏ$agV k9,6uc?nI8{y2:vĩo/|1Y{(Ubi Y+F l>뾚WY;JܚyBOsen޳7ӄZk?SXhp5p z.rvvwњ-I'j= d<2)S87pt ^4S`+7C""h;",Y+ՒU?Vm- WZ@B ! HD@ qNRzg=)cgZ+6 J X[: #7^n5(8~ENYU>8яGx1} >EzFK崁E ¹+d)!~n ʿ\GP}]cJ᱅v&ީ FU9(=%'̽ƱxU_]ǧM!cHlJ= O~ёI5cMG^HRLiw18>:_S1pn|JnBטigs)*My*++w3M[c {2iG`w+~h¿t|^w$E +h-C? ӈ^g{p&XC'iFu RA&*CM/Nwz܏wcbH5UFV!a+0)!DY(A2o2;ND Cҝp.qvD(be6E wT;z1s0w[0'"F^ͭ҆Dfxdm&=7!KY'wfy_vdũ, ռg-¦I!g<ճP-%$."`:1@+@g5}FGjV܆\ym==!|Wɔ\u0Cxn_2+WvGG1,hm7rz-Nq whvm.(8\pX`[MFvPqbITPUQ1Nê&5|X(EPM>W"sϩ&@^;<|(a@ Rd'@4y$& %NxYK8'غN'w۸iiN:tb!kER/Hq^kU0 nȗ_xWMQɞ :cVe{ƇUr׈'QkoA)'mOr/2Nq TZO (Q?.J";&06aox푶;Κ^H]ܝ>ج 4B 1G?aup`x %)l6x P=`̩KZI e5Y &gB4s`ӂ_/wmo%=讀D`}ub`q, -f :6gY p/Uyr.5&_}>ELbum uFF"§*V׹6NJa[mJGr3q= (tK=A/4{sϥ ضsj4EspBB@,/ ]͆s Ɣvւt%dT,p|Thh ch!"Y=85 h~=;yv{{-lXIvH)wHu"nr[n nkHXqq'bxq |b ,' |M ZQꕄ_>vz>UoPy®?VѧKлK9b%%{?-IKDqG=%=.153o*sx߾PS''!AR;;ǭ1OK)l{Ѹ7lx!}ƪQ7wqsx3>:vpѸ~'l{]KSFM#$Ê}"ڋQ`jǚ#^{`!~iO9ao+SB12턗qoh=%DMb@:dC828Zk<5".GIV3t/G-7d bz$?i~G"v -J,`dGp #ߏtEҐy-=?yIR2d W牼HaJ;O/)4CBOt c#+)1>+p'=/1#2D{Ez*YBɼ˅! p;B6rBϱ/8//b[[jWwl j>tO#BD-HҮƧ3-^ߺG@* 3-|^[[ RI.B /u<>t^[m 5[L'۷ґ1M֞h<:l|U\0sړoi=H9u`%5 @dSmp2xfNis@lDD%8.1A@c$Q&*izuOҨ*$;ؓ7g=·j}qFa$2 l >kP㊽Lw*ԁ@"h_[XϬ,135xɷZob Sϛ|zL&_6Z *~AoCǒڅ*ȖGyq;D>rx#L~g)q=y7n u&][>| >tFz\׸3)nc=G|z e\} (ףrc]}àn}t,-~B&c{ 8sͳC"[057v] |Ţ3.'rD%"3bhw5ɐG3+.w7`iT**. QOU7 ;l`B ]o}s %ȇ ȵ;DOBB]"}$?Bp^+E[ёe#t`NS5 /9FeSZbW$́MG3ic^jo>B #Y[v•zFLzҘt·iQ% j:~uUzu+_<6fq%EjY*Zmum=맃u4.gc#f>1*>Ivˠr0_轩Z+lw6g;~], Tx! 5@H>{恹*b>z ,Ry{ZPC4 E5 ^]zѩ0z1Hv3Y_64aӊ8==ݾ*n6=v 3̬)@{%8`tYB'P h7p(%m6Mk(~ %f֙fywL &mްx'!L֐Y $|8I\^o-~anj8 zKHH! #dY$P@|WgG>q>-# !D0"HCyYOzgB5V ,ҞtOlzLKu,20Ô{iǔ0@\C;dB!t*;t|]#$$bHB$ IAb@$E$Y#@dh;դo$7:<_faDnɓ*jRaI$!I$@dIB$Ȣ $H2{wdb-&:. 7Go\ɕƈ)#D!$A<~~/$2$a$X$$!e+Wǒzp{_O L+}wgV+QD$d"H 2H8K r*B1$dID=~$mޗ 2pg5ȉHR@ $IdRBARDXBF@dFABApYLtHϴ@5UifQn|*,keUhr( !s#=ݾ-<лqGDY]Yە@a>)" H]iUJK(UlQEڑ'lWжgԭV7‘ソfdB-h*v';Z\-4-!Xpl=1[dC͜=Y A&hc I uE%kJ $Picnr]R.e6̞F WJ;1xhkzv586mɕM&CAqԺ50 (a2,D A_iKh9 Wom@I$T@$Pa!  $<9ms+sgq`]I {Ff7}-bX/;.y^{-Z?{?y6N2 4 |_Ka!DHMCc6v'TLi>YSnoOFxe}t( 隩)9K"& hwl\Jef2b8` `@!Mt9RprҁZAֹg0ͥx~&8Ū* &Њ@ hgQ>ľi5ĕ?>j 9$SORSM!Y?-1̓'r0gt7ܖ;2̵h>F9jj IIط" ON~8G+Dkh+=$?7I7J;羄*16?(<:U|]tddfU6L:SR74եxZLdX`o<)+_lw#mUh(/O{/>AAXD, "#@4}Xyz)`1<ޑPb fdXBB kʷequ}S#Z; ["iKsBU9K>a^H;#K4b>W6>ykjpJY.|N%M;Mi%*3T*1m0|v}8z?:ZdEi!e= n>o#7aF`RBK2Gms{ifދ?xmHkD ^2Q r ULO.vl>@UfZ+3uQNsCx`Fe3I|3 JL4:vXe@iR#mHF=icة{]ePx~Vaܐ;|^vopcapř(oƹFpgN `Fn4 U-[W70';ڃDn~$(ra Mʂ9e&Èn_:${`nWϞ1-;Ef&/4>?GvsT`=lHp1J~ߩ,.tavubg7 !cѾ/_u5䞛ccti %K%C R3•p8}iN!nt=bC - B@ATdgCL<;9PKr7zOOwhwxѽ1bo&VOeW1+U7nA%0|a y}f,>*:ߧ?[P =}1˵?U'K DfD)k:B2d'Ci71צHFiAy@HP!`?1B!!ARms˛oq1ixꌦ*YBFX:q|As}\cZ +7z,%;ʺ3= &-T4jE٦(#p~>Q% b=@V3؞ܥ[DK= %}) ($֊bUcp2üg~#W=h"DJ(4A8Qٷ0&L)=TpN[4z#iq;]k籀jH.l8ҳXNQZGƋ*bZQ3=7+jWOv]1Bee-?5]*~Pfv=+ؐ0IxԘ~Wz=}&/dK`tk{i8nXOOeڽ#m_]j}sƟ{wרK B WDq#%z\ǷOpxr1ÖEJ(I_0n:y/S*K5?M_7Go)HEĭo#NN=.G&=ۊM?!M$JbĮhG3BL79E=Kr fEߥON (˅sQ2Gמ䎾.2H߅R-rlӪuat?qܰi69Ql[Ֆ+“n[Hi<@QqԕLǛ=;ov5v'r҅CUطV x"#Qz8y7RwgMP(*8aLxJ(1sxͷR yB .,Wr,g9D6-8Ϡ4@ұVX|C'3Ⱥ-G(|U_Ck;Q͚gkK59"(JⲒ^o5ٟcMÝ{B^H˻mE_MuGH`)ї%{e'IۀUu4zbNZzڵB F֟z% Ѝ\\.ھf[i^$0ֳMNZʚW74 iU$)He1@J@>nwcO 8kywgdbrv^.F<8YLh wh-SDms8؟0mz Q{}B/HĖH.^P$)(G UOegzUJǼc1ĴdжH,_t@856kxWe#o4NfqQRe^NVGꝱ) v?҃orC@zӺݮ|_Yur,0s$@R%x9%Dp̶)ǵ x6`\HpV}v ;_ {{bCO{Å|xit/`\ÃDefџ1ݱɋ2i}zB~xk?:=iد]Z7I" 0T 6*=_x'N.^N9 vxpg5L`R#L`1L{.||Nn{^'pX?js~>5=:ޭfvt~o7.̰?W\}+{_檇E1O/Sw][;(FW{ b! KW؟jƽ+TtlЯ[Y"q'D Pr A/mxk/I@LI|ey~VOAczhthzvr[O?XI(֋5ªISl4icuk a8d.^cfisYj)@ݾFw]P q "59+Wt #9L])À:adLn_ YD_Q/"D:)VIiX;r@sU/8)]_=Mз2h%]H@rmOu6nNN 9K7´ƕ>jz^v_h BKQ6(;D6zuߒB2.?jµtx1fOS |\+5'(}gɽl25+~9']_#n7*Oj|ЁnNK~ SETԦϕP>3n >EY&NKݱKc2?c%s F)e1T7#zDYqOϼ?A@\# eS@JMjR7TiK(uu^}pSeJcBzHMUvdψ4C$8Z :hbѿlg&Qm5q|^eESqU 9~tD@ N)ݧ=5bs>Ȅ(yU*:WH\XyZA y.4$ȞEy7[.;>7*ڹx 6_iFs^q; ˦ZZ:|U:rB &<ҕ((F2ȯEPD1k2/jQHJ&Qn8-ˬ/nZ~?ʣ^&` X@F)7Gֻ?f̙)?)[zOAuB{5- =Go=nd_1*NKxeD"9ijbu2M#P͑vW4e[[k {us^(4a .YRˎu;ꩳCΤCĵ$<-NgO*:POP, :I;qMN ǰ|&}ğr|MxQD#|>gӚNd|"ˎG#bߋhλQkHCQc/SWfbVP`R<$ 3݋Og.Ȣ$R ekwzThۍX+϶ ^|ݴQfuOG{^-ZG̋*ӢWF]Gkdpw*h}D0a3J[‚Ԫֳ2x hG֦pLSB.( p2)ԎA Z$ۂy}YhMSFtaQ26RQJrH:@d1ߣOv(ykoâVQҽS|Ygb_ ^_8; 8EʔѻTԿT՚ޘ?L'\mq;`'|G25~+Є '2Hby死u "DL([A= m4'h k] j6^OovXeym1L_BiT^:f>#y},&2fO{ )=P}Ϗ$p!*d.unf`ʿ+=4xϐ;[Q03]1HlirT2log|=\ha{͋7ňRg[ +>`+#{iaoSEP \J!ﴯztiHq%mp:P?\/GB?ҟkB=9Y)4,x{j[B6, gxN]yRO%|ąc(&yFa{A"΋Ld"%B~ _v kX^JJɒi}.c7ѕUU o}_VGQA A3>M\oo%~PK∂AD{DHBKJt"٫gK4p'}kENג7#5wyTA?ӌ}5mA)("/Rtwxf7i~~IDɘhpČ%=Ì1!ƿUL~ǵ} 8͛3FWU@3'GU?G;E'-"FyAj6Z{ y\!Q`~E9{ vR}EMᱢG[>RhcƃL@x4!.o1ӟꛡ^ |0t*ҲPe  gT`WD7'{6Mۘ.!2 "z txVZ3OLJ)ml"ߣDKe@#鶐{#pn4·jG`' Bȉ(n\/E''jmj6CiI_[e}@.GJ7Uqk ԕ3N<{Q'sArܭ>9Zy}ZUz'۶DfqT=hGbpH.I*\_q$wj&ۃ_a~?ݤ{ݎfKGf9?.H; >thg6CmbhW ؎7eʼn6Fs쪞P~ﭟ<'\_Rg9לH("޸w,:eN[myXBE *B;Cn@tb87|v h0OXf싘(mfG ZoY q3pj~8 1V78$nVJ8:\¸qߦ`OGwLaxe?եtJi @( jgQV.Y{Qy@]jUւѵ ^l&ֿEf@΁3}2Z2i1TtM6ygpu|,(1_XZyؒTW{Xyȱ.JtW R)!aӮi*Эk2ߩ[=mmtcd+ĮϸF?XuMjrY6}PS({"uzd'TSG%nKk1_v?%6~v m1OӼ cA4Cg#L<KtlQOZ'޹|u怀; dju]'hg^xYG1!B`@$tݾv%nfz R-22m#L9 Y8ܽJ.ᖐ/OG{?aL~4Ub}%c)Sk7e4GW{=Jo}7ggqhA!S7Og>i`B knS> o/^z.F+}!h{Q-Ó$3 &@MYCqcqz-ga@d"N'%xrNMBNѩp%P sHXhE~+lNըP]!M&ϯ rY\邚S >O/UBYnr%?|S%<< fsx9aOzh]682]9q׵)cqjD^A![z_G2Gր]|=-+@G_K*C_l?a鯒}2b98 :S59W8qu4=֥$ @XIiѓΝ~>EɰyeEdӳ44 (:˰ޮ ;'i&z Vޱ:,[vZ˥u>u;X_X[#][qDQc OcVc:dES^I=aQBǷ.|9F-Zc`vvDZjO{Rh 1\1r-Z4YyZx? 1^-GvǮe[ub{AT*WH'c*,BvI(l$;)'FA>Ǿ*ʆBva=ĸNGAG9(Gt0cr}7, r9@ up^\щ{>/wps3ƚgs_zk?7~ yK\' \ =sxO2џ8ݷ(7pP*G;G9PB򋚿cb!"Tg.e$Ql6NReZ$_)@6 7V! SYs=h3I\xX& aJ M_(㒫3S{e Z!vv)̶ql, r+Ra5\}+ie +a)dL&SPEOeXZ8㎎_`C}z^)NUtyinGQt40hm(5V# 79 &3u#=Uꍽ%>%d5VRɴ#ķ`C=kw=϶ ]꽏γM$a%$7@"|ުu'#-:ץ$$)Œ$ !g#mwvu%:91C&}2 6_niw:-8=+R#yjq^Vczdgy[ vs 9@߮=\V$s_E jU=Vof_[9S# o’f4I#}֛"xf@Q {.yd'c%HYQޡ}9HtܿM'  "Ѫ5wTe\xXZd+?pyYRPAY7 @)ޯO/ёUe 7ɿrKgK4.ziͮw}%3MSIc{ X!f_QJ>%[{_B +]/?|o15s7*\ns?%G&Wҭ=lW-kvrL}>O"J>{Ӯdri³]H a9wWpI}ہ;Jh|Г W‘``?s.ٯSkC㖄i1)e쭭\Y}zwޑOTV;YƼk ]fo/[dib(+)ur^ bhҗo'z-шקo8f]sѱ{/3_GY^N.BnB| ^#t|7\mMoot )IRu77:Ys2{ߞtxLL3zUBe؇$&pB 5>u!R2dFhp֎õXM2hd˲*x>zh~e{ a]CV??JU{_0aJR]OS8O'Y3SAnbp;D%lB;qNvP'`Lvwotf0bٵE'AMHV_!>b0 .~ֽKIZfPR -ٶx QEQF^_n_gRlRؘQ,)(2 @E@6??O.mqDB}S=g'z{Dh1ſ 6zէ U*S}H5jIn?j*t^xUif2l.tesb\݂VtϠv=rzGo;X}c众LpTy3IOl-:,LXLY$LWy',p\ d }!70TJ/7Rp!/U3 <&Z8TٲyT9F`gvI`]є2al@l\TxWyyEt}")ҎL#1y>y g"g?6V>@{Rk?3-g:э^=cGPb""FᝊDv -3xcT3@DSKqq|nG;M5dLQzf/wp d=ڃf$˂i}FJ {cК_\ *wƩt(qjeiLM7`_B , -ԙfaCrX2(V5J/KnG)c!DO͵ޣs;;G^?Yvjgw:M\m8kF:sptR"Jyg)Od#-#n ,ʀn(sV=85khD9zO߱$>db l ɍƳóG_sh\AGxzn}H{ B&#EL 4he8>!]i\ԇ9$&Ol_?(mu=l}Bw_'yZOray˕( wya s4ga?w9"^D9ڜޫ{7wGE3[%BoK|O877CT|߲1xlA^or?9cG?omٔJ4BM˻@׎2@]H۟nicY"C:np0淰AcU|o)#7lhSx|Ny]( Nǰ4ٍ)y oY6Z9ہhO).$MJQN$Z"хVՌͳɁ݉U?Qۨ<φ=τ$+Noza᎚wM嫙 0Q :!׭La#d0 QGށTI.TCNܦ\QyށºBi`%'AOeʐm|$F>$I:|=~_ٻT>2E6VMw2 30ziVgzב_mgQ|2 Y)4`sy>;n*!nK7٧^ LdG1Ψ"loY]^X9:YIxL1sTxW&X6Ӵ\W ;M V+rP?_VpݗDpJyqT֪QZZj20EP7FQo=#Y/ü,}/xVIÓ7zkx;eTw`w^cx$;':·7'm \z6ۗKL/K50.*]IBR;5 KweiTcinm{W[p"nMz٬K~p)13Ogȁ exv{[ }u@>9yƂ!aRI?-Pv1SYQH{xlU9ʟoS}ww'*\ֺJޮOcqBSbSdo_}l}=M{~U>u;ICesh?z_DhcmSC}%W?J݁8.H1K{??ͭE,s88%\;xƛ#꺍jʷ>^ͮq/fL[ :t>u}V=p-ՠ2wC 8>;HA2M;lF/H+"f0SOTq!i*c%*u'$^|;\KL7i6godm麽5QrHEyoUj*xN}Vx:0/Qg_ap ,Խ?g'Џ~;^<ɜ`y!Sq36b3\\!&m3VCv(BP ;RY BHEi~O3jM +nf4=ªgVޓsUjcs7^t5GyhwzXy6#kh[tW|f8 ʓwO̭P f> !m)㩼pdywy_RWjܪxU^ܡWK;Tq%zzw6G?k*~)ñ,!l3zo:jVUau9Aqe슍\8d1T^>Y}}ĥnU`-F>9eie@߀eK ƼQ-S4c_'lӺcH.~6,w. a$kIb܂IJŕԗg4TNTf(͞^_lKdY&mr>2_{ܦ)g_[{@y2YI=Eo귨oі X}݅%<8 ;(9R-, 5Xh\M}&Qig!i#/~VYx'5YeNviLR`syOEר `_|̃}Gz_{OyӨ>d+L?&0쵺vK-B&BEI  e$W^{1Jk 1J;;r=8{#Dol9S+!c;;!,D3T0ɘDW}>T"(v.ogۮ_5Q5Դp+$8*)Γv+3[ZE𑯡Dm,6F7tVfR):8oDH`zI8xE~bjW!a_0&@͚d~©LM 9ӝSh˂K_G'{mt\vRH:"E ߸+j'7&l2NUƤWm)xLљ2##Yԧ\RJg0<䝯WgE4*YE~ɝY@OZFlpP|G r:{Ҭ2uHPHKFm,RD Ѫ`ķP%p r~w1?/W[MK\;7;<^ovmNOBJ ތL6Y'ӡ2FދudOBՂ%=Ćo<7-9KY_1NL9G&ެ&d̤~)؆rlKRDg[=e |Mc_W7h}ii^1aw ]pz?ѵoPkDh˵4Șa9EL+H_(KE\2,W: 5~|S$H?oa/}a"h<'{Lw,%tIٷ^$eK_L!X3^cYSG_ Go'(hLK*JeQK:mr߽ ҹbʂ{;G OӰUl=*{]4e'oZeKdn@T)ײ_ Op^-Gi:w*^,rv=)Jpiy~]4/.$deehyq+#א2Cf2=A'#r pm$tX*Ɋ:,Zϰ<Zi͊'q{|'"D@+Sc1),Bo<꿻@2DۙYE#c˫t\GSQ-}rdJ;Ifo'NL[9-oyp?+~T5'H!y>nu#ON|VQԽyk W1'?S!w cɩMn*VwT,0nZ*S v1u*@Ǽݐa aUe^0IyZ+2}͏<(9/u˜;fw4Yc@jw*]2]B晛\/BkE'ѶTʆHv"_~ܤ(3C7[rq @uL!IKeX/ UKH_RX(H{ʪd Q0quK>%L^J!@%K;ڳ -@D Vh/Y?fJFύko t\xu~I:igI?, p2t:sD0Z\a [D o⻢x"m4z>#]jW=TC@L>1 sb"P R?~AaṛsdWCw}>o 0n-b!y4baڼsΏ9/}KoWu/d[}n幋@dlu4gsN*"tWYek0w,qh}Wl`h9Uivy損Htز2yIR{\ ~dvZi~ta`Y`|1qkX$k9 iuL6ش e_&U>[-)n~Q][B=g冡FؿC_}o}h@uK'KBc54&S!1v_|o"= `d:k) E$Cޱ}޲oшiϒ㼲2 uF` dI&k;t︥r\|恮P"1}a{dF_%>vڞ~KsnxNfk[ F[k^X]&M ^ie7⅄;B0 ILeO/sIY2jdRP2H&,bQnRvL cw%￧y)=o.Y{l{^ -61mYDŽ||D~ }ߣ#|?%|׷>wY;ìER%QU.Ot8JFB.!mD$Qc/6F,v|R HN(Y;fNq \յL1;A?W> 84D'ׄ (YaBY%LA赾;9Oӆƛ}6nYSYBGSr|BrJƑf>Ԝ|Ƽ)'SٴPWpmp&rKQgDֶ6@ 4'P >8%1E]L΍iBLoyjNuez==Fٿ{AF@eTml=C\>n )[mbVv ( ^E|/^E=oLS‚W9܇IBVB|^scnR2vߞm!K,!(52 xeCsr]O-fVB0B,s28`3v+/1"#bBN(7_y>kKqӬhbȋ/SݸpNq5_sD@([)~۞σ}%]S_5{U һovj 1 KoB5ےPxts`?(xN7Wo$@20oD0@!BjD1G{D8{Fk A J*U+ \~K?DPFKUܩx_'5^iac; Oc48'H*JO^(r+,IKjx*B"A؛BɦdZh|~Qarp4{ur=A=r)"GŸRr?@5qk(`h,/4}3vrnWwSҋbKa7D1{)*~D@U󝸩-N$\Uqc[fTPAZEߝMnT'S,0 L&vg$4x:#{ y7F XGX;d<`nݔ"!"F2 PxF?tOOt|`-SSS2UVJĂJ)VTP'ueVό>!<\d\~C>{oD/w dHiӮR_fP)ЗS)@PlJ/<%?GNvչWv+lszFoΕ(*e\Їy/i6>8 Ud~vȓFqsm K ߕcI(2R|<ց ?.N׉DzLpmd"mCeh6[5Oc9=MP #U\3&Gl4^VqmOWyn=,y9hMa1\F"T#u{"\8lOeȎsNo:R k)(vY%2o 6 Ϳ%e񫁬EhxֳK_EEڋ%UEպ?EuslRP'`}/w%4$IQ[J:R a\N2]~W #{7E!1;1BUD!B߶늜- ׽/?Q.Oe*}}Wk FI`\7#[5uQVO~8k=Hkͧ{n3`Ͳ=/S|rA PB@B{#3{+lI@;iǷ_Ю+$d8͕)=>8yڸ~,* 9 %i$#:޷OX1uf Ix~ޗi?(#fϕ@7'z ->mgs\/)**5/Sު"cww"2FNÍԧ:,C\@r mB? éov An<9WljYwlLN!pXE6#; eV"?سBTδL,j3DN.JWGAus dȂY+jM.ZtlZn[ !B%gNmA$~]!&M0X#Wy\Jxz#gS,Ŗ9/-:mh=czsPSck!y|$MUbQ"a+ng)_kv}] a$b)K9 )?ۼw;,+N*PA*>Boq*!GXQj/ވ? UVJȪ1Y,knbw*1Q\=~ch Oyn=%<ȃf9Z'#U0Ѐ` rL%Gu_uR52>} yCDi?xӍ,TIa8,x=[֢ctE<%9d>WRA%xδnO,tUx_9ؘmJyYiiK>rV&DNw;>O"S"n*F1̒yp391q8I"YdjYlx!htMrCSc{6f>|!93ѸcPIy9SOJIUZX0Y*bQ,5`1M'NjU{d)-b+ƇT!P!=5ip+ei*澠G^w?\X-ρn}3yydv&S|w/'VH@R|bWdd2G#Zs6gMw~ Fsخk`wos/MEwLg4Dc 0,#DЂ[xKyf1 %$4[=? WT=b͵,Můvo+ǖhdei$0VȚrW߷6pMl 8_ Ӄ_ގd;opp x6+"fèUvl:snVJ] ݝ+<989։ͲKd % Lz&E`yM lz+m2ZWoBQ ]1JZ3qM U'kmiO=L~7ɨ {oyNV "zO׷~F`yێe']^䒭`|A07@=)}LynYHZצ,Q MGG|/rNx Tyk~/96XO$z A1hZ(?W}u)m1].$wXxF 1/b΢%Ğ&`ʸVzy^j@Akχ7uy TRYeB 1j)O;VEin<޺j«xǎ׼܋pe>lOCҚ𭟖NbS d*fLLpΔ|Y_ N㧂̬IX*v?N&0@eWVP_>Rt:߭IekTZβ'1^}:f,bXy?Gvqn4xZsB/ #Ae<18! f $kkp[J9H&<^V[J⬰7+uEspH~iAoZ]+@z&_CG{܉=rҐQ)Ms*$PmNN̫ $((/wSδR-cfhS3E2rP J Sj F`ܸ^I[|N[&*KQPd aXBIŐt- ;@C ߾H @2TMy9a]8"CBn7ۨζ֞޽@KZ-Kl'vvYN BBRղ\ʏ4x\4^BGϵ+i$ t 1JX^,#xuIq9)0E>C(P4El@sΟFG4%d^Dn=ݕ0 NJo#={=Ե\̾仂R2Oȑ9s'ғ"σT%T(Ы-OY@i@j7@74)] ῶ+ܶw6m>9fxoĠ6 %]*B5%N+)f5HEe;,} <>h tvm4*rXrZm@'ZY,,msT-RaQi3kI4D6ƮYK= a#40i >ﻖ_0y+D7#f_4]Cy80yIcj: w1,q u4ObM퐟Moe*gV$.C5r|9FΑgY8sĞK9WcRs%sHȬ*vdj`Rz =rM%݂A~}<2ub_8SA֍Fd[«b'`Y{D%@$3[ǕGfIqtidc?:N&ro]v@ t[ʹ|( %50hdf _0~z߲Xb Ȇ;j}=i͕y pH PTɓEm$15gu?'Z&^A\,[9J"bd!hx 9xaA=t9 oqîīsa4:E?P*q 䗆s̰gB]DYGˆǖ#xaEgBeCz)CKɪbr 'c".˂+?Ц B$D : !z\ʙĄM+(wO7 KўφqEOoꦕ!)7QtNbvN#BAF[Ԓ@?^~pÿUb{?>d]G;`h~󸟹MN4jr{ˠ{cRYz呓m(yN^3R3jz }!t-x&[wfeefPP$h/DFq t@;㋔Sӊ,ttvX[N0 <:̉yJ398#:P 'E٬[''9c6p`Hbe|gP+.C<"B~5?̘;Ҥjh8O6^$ z,ZB=#qQYRW&"`H&=M"f-0ҝX~»kYh?< eKddAkI=SKc8"bь5Wueݐl!^<$Kf&phnqWiLhb؈QCNNnLܣO\royll:&xa`Lfr_1KSCÁ¤F/ bEeiVO-bɶ5 Y 8Q%x&=eش>ŝ5ήp]'_W.еXY`iP]+d'C7tY$VIn2SUqiʐKBFcߚ58ua4Zn$ϕ-Y+"!鶯ctXLM֣t )讦n )}mD }jbW|-Olgڷu~ꙪZIe6U; EoUKcu\$/\8ht=βOf@?S޵r@FP0 8 &O). %L6ZP) gsf766)GlF*ifQ<@иiRP}&fIbrTha O^)̤yf{.|(uNbr龱o:Ci+/{'xZ27'%-=91&@<$$ HSQÚR[;b,7J^VW fN5m߆3zjeUe&D8&[28Q,>~60$pp wrIY.;[*ž Ap9(DVi}%o7\WHO#9zL#KSATcd^)M\LqtTztz-'}1lߤh n5Ć:M[{|5)*muqfr&5:h,Fn޲~NLuU?kJjL{VO$`vUX0Q22pR)A /0Х&K]?'w{^ձ;r< vQ!"'>dOC=9·އ\N)'Mw~**A!}:Pÿܞ\sQJ{}nÌc3L08)دx'XQ1L{x8ymK!+Qe=l|n?EAT ؕ*҆^mP>?b^;Kܮ9҂1=G| qsؘHjg :>obTÀTc?)d BŻpE… b.ͼNg7K[i-Ƽ+jh۵" 9o~lGU`hkJ[08;ܾbGe@橥"D@#ܾUEͲCCY '~tpr}KKxwu`_sE pm=]uRjY-R*X^?W-O㈰uAlQHYhBIc]yx Z^5:P@/s.n\ѼۊOH& Cܒ8fl=.,eePd辛=!;|Nplm*.`c(jsx[ (3EN%[sj@yGCa02a;؂X9C6\΅ Iq~:c0Ņ ,cA akgcK}LN:h6F8$9Ѭ/Dkv1T+u,<b\֥')ORBԜ{ T.۔( 9fpC3hvٽ XcHCj@a avk'ZYz:JEI7#Gi`Ct#sۡ6&2hGJ$qc>d.Q Aj[eک7c#<8,D3Gp8"l%T?n}xR:cq՝#DA;6M!ӎLwx_ª&pZ8zpE 7 uQv|.@!C׵}UN.@i#F,0{IB9~+&,DwD>5  x[VG..Wa?Fr$gX@<հ2 LVXA_; }yqCms GZEe/`vp/eWo'lSjJi; ׻;uȡUm%I ߃UwVtQy@y8'_ӽj @ 8mrȍB)¤hN@qG@pQ!Y8!st ȸuD9QU 5t|*- Ժ6y9QOmaEiP7Z~u!E6{)w\!a~Mg¢5} >^x S=3h0ao>A8Nw9#Dsn@*s={8 /a~zӥF`w0E_S^%\Imn\D7?ʫb2n[^ct0j _ &C,_d4*ݫVGu{%9n#۹JᕒLdMP%,ptݪ o>0UG uqiuPџ5>qx &>ڪ–+^N$hZ[7B"cxK2rCM²̃a@Pk9:o71YCq>6 X&9݌/3Wt``8Y@_w:P~r >kMhi?VFBhА kH%U^f$maopu-&)u`̇^CޝU 4.nR)`0Fl .#l$?Wp Ilxc[ A wXBL%fO2}#[$I$۳^y|m *>*ߓc@.R*k@UAK ;^{ >Ȯ/0;e|çq)+]C`)8bLpI9U@[.g-xH1p2>\K@.K{=&Τ̑꼉EQc땾6}eQ2y:>^J=0 [ͫ3Tk %ʪ40,\ .=wi6|r(Q;P?,5 HY=Y]$?Wg;c pDȭڛ;{%`m]/v7#%kB ELdreb 8sIh^4+,qݮIt@9786m1Id>q|3WP`+a6Zb8H!yܣq,,C~e|jtT˿[0ˮ]iy ǽfKqqw=ihE2g٤M/k(xe4U):)mhR&FђKE9=[ ߍkn֨7dwds $񍄁ݩ$ <އl`ACаQP82GSw@si0<3!LYOjǯCÏʱ]u>[5ٜ);Tv\D,6*rIb[EBW>1esc)J:Gf 2D9f *h/î2= 6sEIlm&8na~Xh|}_Aݪ2Am}k@}[iD`)r0J Bϋvt$08>3!sFSřw@ڸ;2'[M1IR}˙vk"jRQ#͏X261ɪO4jAZC=1gIij^@kC)]#t;įV@cЭuAi^&]@_2emyU\ *&htGĄQco]7cy͘?זz!u_,Y]8r@?7cf*+5|ξQo"G;$$0HM.t'&E'9{Aғ=txcCL8'5W>(s24i yߡG 5l>bpQ ʍT|'5*AS6qGuhi);}$}7q[hR#MơB+V*1G  \ARv+!L|m?D?]N&)͂nl|b0yqze-pdre/Ia9Wg:#z[oNׄ[nS_P npkDtlX B]g WEAۻKZhi/%bYZX|ϳ6Xwi]s.4I,<POf $e_ƈ{|oh!v\dxosp:RiH3apW+loSq:aN 3 ¢"sXE:]Iik4=$bJ\A?@.גu'4pUzv[I4QK IuᳵIWmpNEt 4'j \ ؼJs]ޑ [Ge#(hU>U߁2·]8 VAkЍD-v%s\c +'De`Új_if+BF",0P VT ;,,+sMUE&{s^[3 j8XLu-]]ERmbc祸XbBZ!!$뗫a2tx@!6%$]I3Fʘ?L ZOZ8MF JBv\}A`yƌ]Fڑ} NM)үp\ZOB{vA-f9<7v| JZp~(-hf>@.d ..l픝UAj> dc}S}mg~6TVy e)!}S3c}oyb]h ~,1g 4 X$JrRHDo}fJ 皗÷یv[ffZ~]?!l]V_8#*($dQ#}7V<[6|kYY)/D-8}smmQ^|v&~ k:*Kp%E։askrr, hD _OW:¦Ng l{ Z1 ͋9c3w"&WJ~}oG<\ᐸߪL7"f#܉$ ( 04kq)X%20#-O/ rd؂)j \D.Uvv!DGI- G=Vf>9u,Br)&JZ) J.[g({v[@G(?1T PGcgY!f\_]0a9ƆT^/*SDA%NbM{\0>mn ' ; œLB#{ =>Җۓ44O1)+gq|OB~`CYE㨲? 'e34סbX̌D*lD(L#( OSܥ|a/28IH~[o kkRDsZOU;J\]שׂfq$ m.:+tJ^7Ui/ %ݯ-Vż][#)k|즎Ę 6/9+ᮐ>@G+8Kyi@tNKTH pY]NsU~j|LW>p^gT`9ͭ^ 5gq?BԃAK.qŇϾ[!N6C9" $+X†ZżR q O=l3])UY ILd[P+5d3jQHaO<71b͆-|łEQB7$TYfU"ůr6c#3 [_a=V9!z|ȨweuS# >n>Lz#OiY[oھ vN9X1OF%ؾ$,%7^|$WPgd)nu GoEe%2'P#(|>j$.ݡ'2"2!]2SĪ4iڅ )t)JRLèf,U(uh?|2n!ᢼ.5CҢxi]ZRpȰ.#C !!|妘jt !uhvHKb? ( |˽ ץǣeU%lndUbw8@j`w5H'@;jqE‚~mxIdrM>";Yyy \5JªvT(`?lT~/˃y-7U&\׳ ^J#2,$~5mIL9hSqaIz+^S;7fe3_ Jb5ҕ xQ}+|_v-E2|Tߒo8c9i]ʠhEY x+ `nW#1~vbHfЂbbU(Nb56ݷ\I˯bK4'^DSbo%#$;f=;3's^"b X'&JF.@iFwG~Xy4r=<~Xw0`pLTD7~̄H0mI *W"j~ Q?("y9"{yuQ?]BI/E< ܽlzvp던 9%?vI.{Nx=YtϷNF(@0_q7-uٛ#i>ns`uyWqmm fB u_{+etiSџ+\V&QuVe@cdi|.%u\31m;lJg*h>*O)sr;$y[y9.Jl$u|۫taK..Kgo禎Uo_0&me svl6%Kv䝄"eSz`g'`#q\V|A XKJx0?Z-HHp*L(RI~ԏ%{QtuKk鼇,.ܓ@+o*KT !LI IqpanݱWQ*8ctbr?lcu@WLR.ߍd<|UVHoHl0̷̫ܰ]7ơ߃֭JwWĆ|Fk1mɅY^0Kmi+}@Ӡ[;^#IB*%LJlu82|Jyh8hQMTSa՞NXy3J_O}Eh֩4@l!S5/nq|%;| D˸3]<5Vah\n U!.CܹX),{C@k6x1$WJb9 ajr>_El{MPi#n>3܏(KubCVR:e?יcGqׂS@~Iw%֍\b者"O$@bAJ.KY\ly2~+rHr `cf$ӑPr@NYAM2=/ixU| ZGLtYʑX@;u/ 92۬DC ^m2= ~GjoioŮfדPn2).I ALZbC ~ %:/4}f034`q$8Π8nQ}$mo%xrޫfAd1\2B.`)<:{" ZZL8ydģ[`e:̄HIga˄ g$DO/ :kGsN(~xN}<DzUv,= N*gx[K7@ӈ0Peu\֖Tx0J)tg}ٝVrAvV A0@KA8'f #]uM68دͯӹU,Y0҉dAM55d ))nHU~¨B"!?|~n.5.-@ adJatzҠ.lͩEaDə<烹A4Jbo.LVf% 1bG_v=4h )M*h4sw^k2b`pS~U& z8o¬DRP\lFcW $)I^L>㪃r1&m''KZ֓A#̾k՝!g>UQUJCA@ҌKQx򄖔"#) Ҟ-LQ3O#%tp2y;051u`A!~{>*i]ЬLn9 Z&deh3!mob@m!)=31:2CMďd<1?5}?y_Gqw "|.Ov*s tZ }!6cu0Ƽ!."ze^=nX:wWK&@Y MKiCyXu/K/C '~ֳwDI0h |}SA 5ywz0zͺ-=NOL<{#& տҰWŚK#mZK [qqfx}*W}މ3'0iZ/~#R4G*^KUhIIWήzpӲ Qco3bˮxP%66]lm"Y=ninlt釩L A Qh!g⏴1(8HG'Iɵ\LV1"5V337 +ct8\&bbx9FO.>@-TG9!&r}oOcII+s/cZY: /rwhԐOU^vP!e6%PB|ӴJq(RqLS3$UA>==Qk\ͧ1D0fCB eG%3"Zu4PQB1<ƪwlEղ>ln/ZM4S`| #JsajSMCB@JZBlm1g#L%a-MT]TF!ϚZ&Hb,# 6K);RNpHnW{I80?RJ ZC#R(N} 7>y4H;9kg7~AŰѠ q=AHI{t"GdvKY_zŨ>10~66CܧNlx;9LZ Ԝ9 6/ğ,]M^Dft0$C&:SDirٚ1 aXS~S#>㷙x f6mpF&G<[ɺerL(Peg@rʬZyLf2 r0!jF/F$}IELP ^91Ex"r Eݷk3lY>CH?U%3,\AsYzǪ*4V hon,-i]?5"W1-X;Ro9]`z)$,'#oR%S|j(s'yITNfL}>kLdN0JO-ΣY{ p~f rY@PH^3+Q _}0ݸ_^M$L,54\UXFޔX(J`w>r!CZEj+ [$yn_j0EU=hX` A:?Sꮐ6/s>jWUZ_Oc[ooU=^[<߂j~< \Ṭk(>6Y}ϻK|nҨl~E2}ҳY '3O#8KcMVW݃z^95v|2Yt2$zb])WXj`27 R:[!5r}LD4a3;|ɡR'sQ{ ,`M1$Q؀(sc"iukbaǩβ!͠YDHk_FӘ$A-k-ec@<4FDR)ƮĐ!Sf9n❒`U憞pvnf٢m*ƔY@r5F6fU,S0B#Aم&q[36[O(1+9@8D/*9Z0J.3To Jp +VB.b, /?C'2_I/}'`C%:.O8ۆSB#_\#2>؏[c9g2k@1Uf8894,{@v 7:nt53w)*Ӯ32p^54_'`_@)Ė !ګ>04TADPkW2b lAn [tGyE_H.$3%LY %o*]F±DafHQQ'IX.̙Z'1<[x? * ԽPtL+4lc 5-@vcF9 yhisu ,m gK+^|W"̊팛~KܗZx9 /啜,8M|dK|`%i(}izq7A9R'qcTl]I)Qx_9l}kDUmnu I\g_ЪViK`\|~%Cڱ|iD3o%{1m^IV3J#r~}x%GmQ<,Ghd`boAu*nq7őR']L;2;4KZ}Vɳ3k(WȌH?OQk꯲޷?~Zw$tdG!Pʇ΍4eLT34]-WGoqcmൻrFpzPG$U J[>ax ̀T(-3dl7RKE*ߛDuwBd2b@]WgF3V/lִFCR+oJQCJF8,ή:JL<4 /ډ6}|RC"Z;€?;44|W_S1juٽ2F:{o>^1Y]}ITh,Ҋj붆m)@^@;ύ>ok,w6@+T=YĨ5Z ^*:NW--\NTk;0 q,:pY'qk JMC:oE_sgs_|\\eоf? %luNœ$"Yܾ-8C;u95%LS 63c;[[oqMe))AV=jtp{9>/0˗ VVyI$u̟ MNXzUIZTte=sZ'7;PdrM#q,a#;NF(hZ3Z{C8#E91O2s`"sUkTq3ڐMl^-O@s&reEBw`(}Ay' tnztKJg^&&=~c\>si  $@ܑEyIKu]<i,AXXGyǏgԣ,Y>IOPtNcx}{NWwYD Q+*όZK~[&Re@ﶔ1K`6D Ax¿3NmcP`?{SLH`ݓ+B DTd+!1 (ȣHl\ GG"cg[" 4X\Ew>zן)^)_Z/ MRؕg4 ͞*'Ls(P-%rJEPz39 tu_`U,hY \{OKJjH 7Ni8-"|Odb-[hOj|T ʖu!5jk'&3zW cI9t\!@TV+d eI\Έˈ_G5ԣi]Ulm ;J`_\5"q?7Ϸ7!ro*Rap 2neqTuDE"U+:gm~6x@[UG+GpЖ C9꫎jOŞ;^kgqU3|wABbyj{RLzivR岻%Ns0r88%X=U,eH)X8-r)^焿Y7gcb)K]y'+VM-c%c¶QG PCL{q)hz.MhL(<1)BKβ>k P:M19j]cbO L=j׺Hj"# ߲M%%@HYbPN)͕lYCʠn>Ko->-ϰPRN5䤝"!s 15\Ȉ/7 E+@0a2cHQ0./ӕ˃(њiojNBa7UihHc5 :<} :xdot, # Fó g_:Ȁ"RGӅesJDrTRwsJ3xF}t㜬b)#,0>[P"w?xړvXRip|캪'g76&AƄUwDo"Cɒ >Tkz4nۚ;KTs?YϠ8*Z, @2 L)EJYM:+#Z[7TR > >R'-6S5/Gnw Rx6i2uηҮlB:qagAn 1u҄ǔj0t+8;/o&CktƥLZ+t=3L4lh(v!Ÿ ."}>K3[Fuiվ 8YӔLx6z@-nV0iҋ{ZgB6& $ OVɬ7:`Xa;/l>,*+v{+;kU ~߈{$,b*2]tO bO"UkOL!Jvvy Y#8B` A`xsJAG^tEPsbvX%BrG}/E;R=1AD* ]f#KF/aC@``\1%p"%9lٝ(@d}1j&p:P`g0IߨmD`TW#ܷ_g4IH -9!"?Np@ 6O[Y~^imԦ6GL@n`1n nc$!?=-kE8\ڽ&r@#[3 ܈h l6Fg$Y[ ]< 2lJ #>6sS;׾a#. \v8\(z<Y_ap R <J7O/8Eeӄݥ16**h@ B PNH'=AS;Qrr@σ䶳 Cc{ln~Ms?|-@F41FXO]>{Vޟ)Kc* <6V9h1|x.a PL,&uٍfEQ^Okƻ.xE͊#S2?j n1 wñA)xўPEiڐ tM+(+y3<<)@Ks9I>=2=f4^[ladXJĆG>j4mɢB6V*lijx~d\+7s Ed:8BLo78g[_uWSo*]e ]XH\Ē Omʕ1VnOP EJV\Z! O=R]-Gm*Nej>;QE"΁Z؈0[SLN&qP&Z?1#&P9Dns1)4jzo?na*w> qIy'ʻk^n!lZ6mǍm6K6mQ,c/FXcZY^nU[^\TZZw|H3%X?m-ϩԪw)iz\_OAhsNH ٵmnSfշ#z1艏yLRφ5L' Qmws0DdjŽ`dJypCѽ^1UzLM#挒*3&l fY݌^+sݯ!@}wJae,KY;Ֆdh䉤P)-Q\ u x"{"Ю˰4Cv֣) 5yif[=(mu 5Df~VLPqkXߕXnAz$?=ʰFZJηZђY' /OD@LD d9>l3"SkSFr֯Q\!Mگmr3C`t>yw>h-CP'F;WTM¬C={XdqۡMveK" 3 2atQvHxUӄwL`4=&3N \Λ?-աHwμ eF[;ÿw =%s6^oMqWD )`qnqy>vEc2N,gO}?wGM o&*fC\1.+LB>Z!=tb_Ր3,&c+y"+4=|-f"5ko'ja( o,Ƈ`N"'(3!%Ց2Cًh$|<}4<򃐰r9`/T(ҼFQ ~W>yvy"p\H~t HȦx˗/9hu1#+*W_M 21#gvEu)CCj}Ņ˟"Bb~kpfy("1x̧tqg=Mf_u|]:5䢡;1FZ k:z Do6* ́2|f tWέ-7Lм!wbi,gzGmk rl2ЫFBe{5r %|(|<;-ZTR4 6]T8X'+SMh5mH2j'R?٘<H\.|*ZSfDAR`ѼdQo{;۟ˆm9\V xRD-{D?Xz({;/~w]F*|ό3İYބ0C!hk%_n`/ 3gsrOO-xEH'!p+#r>?&D:kSzmQ-Y ɶ˲*I}?:UIc[7Z F,T,(\'cr% ]9??Bzs; U ~>2ZDWaPSRZ)V){אqt:ц /Ml+2+h.ڔt/a`|T @ oXg-rٱgxkj]h|(d,"#0r:N;l Sxе7YvYC-' JLὅ,Qc$>Q+}8h.я9d%7'~6c8Y z\&x0So28++PEiRI0.롧+M5EymŠThːn_pQU YC_URvrnlDdB=C*0r-QPu}yѼ[@xV :4bA Esw Mp)Zn,;Y#;B#)2qw.N&*3_MV՞=3X0t³PPG2rEH^XI,͚HXJȉq~@koo|mF<ȸc]jFTG+>< idځ<$bt4,L2$^5r1,NޮY}NJ%8O.^C 0yCG-D`pFaF\N~7EJi5%amFHad#|5;Hd - Yt=Пۑwhћ^;VF5e!tf&~BLෞtbeB2dl˚ē* qnm?.B첬Zp{6HT^I;Og,s ߝpWN/Fs Im M- ~{b &q(Yn@B(6"QP^s8>]0ȟ ܔ6+όPWCq㑧:]͚0υ <. )pcGlm#0x`Wb!hBPT1f/ؿe2'/B٨%鴵53*K?uaNaB'$V_c}_61szvicK)ASمGS:3<5rΤ |%+Y k$ r۬ vKխ_B;.U-& [l>MaS-Ok{1fldPxKpn< 9DN&xHhϷ8ŹGQ/KhX3)Xusj\͆+Ah:rFky::6Cpغ㛿LT &V1.͂n_R&snOmB:0-9Olrq,ANjvk6rLh[Eޫ]W/ngVkMr?_mksGwgbsn"NH]GLnp/n8ɌeN!<._ʎ&|]]3eI]|.UݖG$jon/ Ra Rq&QGxn>D`@K/te/wwNueLt1 +Yƣ0b&˾a#@rEdQ+ Հ^ͪhѩ)Ŧ#_>!Ycb.7[DI*Veؽ}@]&E{3HX%H$Q[(8 .iG"Ug+Ҿc">Ŕ}H \X9 )6刦')YaˋVKiqtVlX*&.%C YB,3k$,MV\`kx!cq%'y|_AE ꖛN}<Qx0\$:֞ӃPZGU(VCzLHND|ao1yo|rΐ%* 8R-nRqj%g?bM0%T* ӒDuIqh!&uӤ-Be{$Z,50U|噟TtoدXY3KSlt@%?Ȥ^;",0yMsC)HFE4IGr^Pmo?V=A|N-XwK#@Bu5d^&վ%,TQA LP'FluI2z)9msq1{\{رxDPQn0SɆ ȕ*y]e[]0V}|SX؂l92']➠6L qHA EZ19eN{ՉwQ-NuJmT &<9aZ tB福WL8D%a !'[RMa(cLAF"S3dPn5bߢS:OL [hq9 Ffi_VwjQi1Bji>zUf~GznݪWXit'$==Txo}Op$sǎy['=ng&^ƀ,Қ0Z_''[W6IH犕yi_I"U SBadq=!a eQ$DhFCZ&Q\ 'z!%̈́hdiJj q2JIw7~s{b#wU-mu^iTCX;y|Zw)\>${B׀_^p;k%؊)l%6\KȓRBDD7g_O5daY))f=z ".i/mʲ17pC8i8*%?7z]Z#,'Lu䪑蛜Jou{lv?Z-}osvpv r0zj~I𲎘LD՛ aʑ(DꁒfQ'@" c,ϠꚘz9~z[%C\CU#$p>)NSЪH6C Hx3#,F΁ 2EaՌ,8Ek6/c{&i!wr"&J-u+`"ߐd>AAV0F k,{V[`_1ǫV>LqV1~i?} !G`+вYuQ%q^_.kox>o#Y ߋ0,rQ3D.NLx=͆ y^i1BQR8^vtZ4=+F( ^׿ZJf0N:޸D\CQjNP`Fѭ +|MX2Va*V<Y`ԈY1{ŵʌa4f V lzύ1Bn+Дzp`CS b=62qr N\Og* h=NVl"edCQ>86D'v̈́yjzla |U߇8ղ 0P1 w"EDq5@NCa+ UZ r٪c)Hb8U{G_4toc",j~țd皜V[yz-%X@U9κ큭"UO _ ~q ,_a9 WmuIcWKiI+,|et. t"zK5 V~Z}Ģ+^JC-3*Ih)9H#cBl){QgaTԗsNrkbÙ!"'wCPCΣo[{PܖyEcfcνx@O=_3.nV[se?o#8! kC@v z箙if#u:(c>}ߣ$tr=*V/ c#ePD1p>D[ٖd 7&'lE5YL7ԣ,sqsSfL摻ʢe!9ݚ<d1<0֝]?+zEA1HS R;Č~vytQt2!h;`lC;fgQ1Gki6guN6ŚDf+E W/If_[XiB=]ch_4-Mgwa,yW#d#S:bv^Fݔ%y][95D;i܃lYW@dne <3DYqZ!ס9HWW'_DkV<]-WA NdCo_IVW EŖW&~¥XĄV6t>W/yEtD-#mqe}1be5̖3J*áz-(~b94;Fx?#YE [ w/IR[#FTIA"1~%u[gP'Q$rc<5˳%ɞX%y,`!D ba'|vP0i$Đʓ#a)9H)`p 5=LWycw*"Ym}b/ӷ@>YhE: :5sj9>. A#-YDmll~Ȳ3Fui?R}xm}EG;z ͠ P\KkH{աČ Z.llj=|j7I39i_"%TT!E(N27ֵvGd.m\[fIdvּ +8q_/) A]!3=^" `t—S7Ϫg`YQ(Ty+>5ӜBfpK?n/%h^wiX 6xfb-*-;~iJ-e B!)6S _& f@pWf%@S<ĻM2b È\M+b+Ґ "g$N# ]0QE<909qLBR^.c @Mb*]nO ["c4~akA*H;瘛ʱI@H#` *a=XK|M=gycI% 0N"S=0y: ƍ9]`Qv j'9JE+X {' |Yd,JEbm* JJաX܌_,dDNɲ\nɄP_&t&)^4+=# bS=J9TO2N!9 ac]5ʕ e`׵ܢWFŚmEǍnROUeut?$1[nnٓ'w(b?GvYzgen4?~M+,taUOWBp҈廸ziVұ Mwc ?L""2sy_<)o5싍]NT \#gY+x?nMIcty/1xvj?] m:>SL{9v+ڧ^4}o }s.{?Wܛ6_Lh[|܌5}!սr?:ʽcyf!"{ŧ Uyu֛D0G?Ikv5_S 6g׬ur`rүeu6ٶiY̛׻Đ^ToͰ>>`5m)|;= kU8^5zdBI }(NQ{Z>+'1Zq~-s>>/]; [ջ^꼢98i~:Y?5czq$Ba(9k[&LsinQERYZAnh3VuWN鱤LjO%Ja:qݬg~}iMwq]yni 8v޾Ci'Msz]\uF&KX鲳N\Ѳ$; N~)7C.ֻ?U>SV;VeD/#MiH-Z44RxU'ۂGwie?.ݟk?Oׯ^eV5\Z.[3վheR/Oub?ޕG:q,0Ui[b$x!YĆ/apSb(O;*}ͫ$gMxj0$06Kmrsi_? Uh=n[A;XhK ak~j̫e¤)4ԎO6(j[NA~%FipP#wo kpHI!TK?k`pn\P'wo_U]'ܙz5~Y0oiu<&"񋆱JNbdVV@[ٳ80׊LI%R$.E F{-/R$ ToXV6p!ivi;Gn"IIHYaSDqaBޓVm gx}~]oRDIF}zn]*iZ)Sd+gw5\By!@PU"ldS@efTOj@c#'^Bѵ&-c2≤BT"y $6GJZ1ۧ[zD/.D4+Ǜ hoZp/HiLe\F pyd)j -1IYG.BQhyl۷XYrrۺJ-BKn6X(m4B[2.ya\G+IĭopM7h5nz1 a h ?dI٩SjaA;ztڢ;{й$`$(o=4|Xv߾*HFc€ Q^br)"?Bʰ"/h BhbRU8;ӹ mKR^γ5ά&8ho|3ؚ8SuQnh"* ^){i\\f #@vޖv9[o Mޕ=v/G 7+lCP"$eZ8ڥ2ʬo;se\%bk!1-=YvneʑO8aZa^xmn;JzђI4 KԯDm_{IЁ 鴘dgɕEuk6mJ#>:zo-קcl ~ܔ.* %r9rNWy'7EUׯ ?ʻiѥX\#פݫwSsQspgƬm%Sj@\mNgۺo\AMmbqZ A @Zņ. V>Y9:@ Ȋ8% ˴(ĢvS/m˅WngYY˯e6F"p]G"a8ϙ'[g:`{XH  #30z:09PDŽY.nc0NnZFaP2,Ge3D4Rtʼnn ֓ʁ$l2_L}[8x>uOyl˦Aw1pAo$ak;S,w019r$8;(ƎO/uV )$um./iR}kpK Ök0^7=*JM.6*Dz"t2 cW1OPVI|"@vtꎻџ T<5pz@mTT>cw)1REmy) 4GFm5 -XTǔg^=eM^ۖmGqުCyEѱy(:OT;L=<`I ϬjmGAJ5 H;W@#[Z( vHMwڞi)5FїxH Q`MdrSprx܅@aˬ((xpIw4"4Qp @ l^P%[!H1`жS/F[uT>鵃  ,Mwjt5;趉ڻw\pc[e FNptd=}(yh]>fK;ɜPaK}j4:[hV{/}^cg׃y\ wD=aفޡhj@_ugvv/"wyx\Cӝ]^G"Ltz{ݙ|Gyyro,8wzg{ݯ6,zy{{Ͷ^og\vxdx/b%y{NkDw3/}.N黧=oh}{; n|9+}w;qmꇻiPW+ k$>w[ק`tl>{yr+)**qŪb>=}xB}roGxW۽izFzY>z8|=0>緌xw\A3}7t8c8OE:ξhCǯqM].!/F9{s+m[,b[vvY/{:'_V͝҂(G{3Wg$If؝;lɷӄM @@LLh@`L&M#LM2M&B!hh F2&M2di C$ɓF56S50S54@!a@ 4ɣM2@2h0&0Sb2)jzh5A  hd0hd4LF&4i1M2d&LFCBhI"iL4ȧ)SȞI`Q2aLA$xA7hd$i4􇐚F=dd=@ɦMbi ibh4ibh44&M2h&`ihh4Q~W9aKpAF &&lqDh2\HoW" "2̠R m`ͧ}ljoGC6'FAڸW@n#0q OwJ@Ex)(p'}rYA? 0eAkaЩ %j%GTa~#9?f$wҒGq)TFR^m[SQL ǥ{<8J?ߒÕa4PvxtD?9:/a{ iZYFS,I9֟L]JvGG/ XErh1I3r͉*`Hɥz#}g429‚.X)f_fr [f;7#+Y/m LFZLmN6M*pUD5U8 ?aeBt_ZA#P@J؝s$ňtLP{ !3|=Owܹ $Z1N] Mƣ :iԥM8Ԫǀm06L9SoY41\#Hf8.H8%HnOٳpԀ9색oufV@{Aݜ )wKx@Zk  Ja_p$i[o 悉g&a#:I QvsyL t.˜mc.8x\U&?Y.O TioYpG:䎟 fg VV%Du uЎWف!\ wKKTpe7-4$@Gs#GpT2(! U ';nkP_Q9m~ { F ct^#R?fK  N``Ħ0*q .~Y5@)ƏX CECi :.-ոjϐXB*ylO'C-zZL6F Nc |{V xb3ϔPx-qVDyegqG`9X$&@НpuXl>Pݛ2|xUl%{(,K+j/onSvoRR}EРIM,iRbF@%jg-ޔ:hqIO,할&J;CTl0z*yc#ۚ˸6pL|p:\SGoG[Nt,">pm8MS-Dgއ vkyݞ?eݽ*h_{qf+Z,Zc/L5jJkڒd?Z:)-k[ _cmcZ̴Lv0aű2 /SXe> DdƓ`XH0Icd~/i y(Q&OCDkPrW8]i %<.zo;ĤKd}%n̬BPJ֘~ ZFirh6nhBgzM,ؤX: cZ3YoRu}u8Nwt, 2__R} x=K옥Jؚ6Ӆg.0 ?{wc7)7?TG$|kuqDB<0}E{xqoOߩyRfbʧ?V!4 õ90ٷUm >~03JmpvLy-9} m=~D:.A%)~vOi36P@ a:mWCaRfΘgifobc3p5f !f!꽤.}zңvj~K1i[zxkj7=N(mr!Oo2/dЃjKmoI|ם ӧ'h|_}i{~VBkVLu~SUf>3rJ +n⒤& /ZX?9yUqsj [00z2MCh'f|F[&6Ohi1 3-x@;hʇ=We/k)i}NڨT\vωML#3 >F[ gzEmV%К,p%=ݠ| T(,\ *bՊq~]~6Ζ^D8r%oę95 +ko85,j.?sco"حtk x*B\LGx򕮩Jy9 wrRJ$@VAHHkEFessd\j&kw]s]us8eqżW9Ůs:\EF]+sqn,n+];"-Ț,*a];}5EK*o D_o?uqnqtqW:%q *+(|e%k{2&|"4Ɓ6E}Pen" `E35;b/XT`@0%bEc(=| 4hs7uܹThCxP`S-uO,1m@=\$_$y8thضOWSҝ{pz3&V9=ZF;ݭY4P(iQm,DHޒ=m"sHW+|vs!iҊK|՚HIc٤S{Z!X1v^mtLE+ٙچQKCd:q:HE<X8$$>v_+UqZv:YMWcjBСY1rz 98Egt23Oaӊ 7ugθ-.s0`sMT\7wK675i$ VhlPߊi/-1Ⅴg~W>)aF vL6ahuT沜^yٽkE0W#kp<eBiznwߝtjjzz;Ny@z&/vPU1yL8Ϲ_oȉi#k?]S?ˡsgy]ck ML hФ]^>i&Y?~f6B=WGQ RR;s8+gٰkN^5˾zSYG<:2II,kRr&M{u4,t?6CR6-*?iKʚؕ/Sj`d岱n5uxd=V;ht:SRxv+y.3WGI>nq}K!Z2T+NNÞEqQ0aWө*vՕ#o:ӏ"'zL<^d}zx$v%IF(]%uaR9|ooKR95/M}\ xm.Lѐ;߃|M|BՄ)<հi_B%/l]X#uYn|K$8}-Ŭ]U.2RŪMΊ栵pѶ -2P-.{E)Qԗcvn-@kߕ:}–waxmaWWsh x&x.3Y25B;U9ݜ5J3z9=.?GKΎgd scv94z6GT8L<~*篑v1ލb20\hN DGHRيoV5sg~2 eʓf)2ȸ:*yBN`.G "5d@^{^oޓꖅ6z/ (=GATaĜg*g#?gӤ答|Ket5Ic1ks'`rȁ*D>n;|,5f‚8gqĭP>JzP6.zpLd7y ^q-Y&-B"61p6Up œT<~R?'D |~fF~ƉZ=(pfB@۝"fhci`+ö X@hQ =O-3AoHV /*y_+ݕÿ:7eW/\k_nH秮2&lUX"UJMt6=d}kV%]\O{6-z%NV^]5~'fN"WWCSy|T ,𗹶N>LgV'" - L=?%R3TƉܳx:u@71D@ڕq;شZFmG>yG j&U0&=bp6vY8Jʘ'z{CTu8ce/Ln*m:%7)c- 4H"gy Ƿ>]΅p3uOh~պ=r7| nї6#R}*{ɭKp;ﰟf@h;cSN.S#=LpjBR~i\rFA)* U&~,FJeOTqwϯm,EsJΣA^rM94q f"fMmo" YGi+=D"/[w/w}ȇ=u8ӵ\88qi{p6^$ "u^ HU$UAd"ehhgw|0$"I ACT zER-QL7ĉQ M浾Jr2?SU9~ёX1&kej(ԯR_g$Mlc/"pU]'i=J'K|*F9si'mW]DA/Ջ;L\Z'&_!R7s0ںcm7o}~rIJ6!T+Tg*2BֶLݾͻYxƏ:AwM{ |M?u݊mpG֢: pl!,fBBe*MnG k\~͞YTڻ[ZS~jrE=;h7j} V|}hvQ6w'5v9׻񒰅cLۋ C'swl%ӔQbXbĂ#EVh}MRj$*A?8鉾}h{/h@=ǽ,8: l߄E&=w>wtWm4\}y @uJ.T7v+vD _Q$-Ieʒz3DnD5p0#@7gOB@ wPMEps NΣ^qvx,6j4fvY*0WA)4az}C`P-!n_77* `w#K0` !@2GXmUd=dIX\Yn`r XK454if܎ ^ίEu yMQ1hk|xp[]yuYׯ8^t⫵әDKrǧ`IzFC( $liUe])M2R^sHV+#u:%UԴKx[qRo 8^9 P[fݳ7{eZJCtg=cK&l7vvQupNq-.MmҟQ>v /enTNW} 33^37gFCaN}ipEC3.1*W"e4 .NJIACS) m.ѺsI;-},K}ǽiyp'y9 @>ue8 ek.e&C8$׈nYxIcCYQU<7_7}OcaN>W3z/>S\-~qz;gVl:pmc@\K7{Wѭ2G*v;Vw}FUS:0F\]|+\(~V_ؒ9;qO7_:q~a=.ŭ;E5}iNUB-"s'"& 7J"@=>>Qb Y7K آwUYx,ԕ0=DZ~$9LC0J %[rxC:[sbÞHA:4H{e2fmCn5&N^-7!_{YsD]_.JwVR`@xShiޔV!8֖2l]W;V0SH48^O iQ‚r޶oڶcT9~{d澆W_M֚RZWGz^s wSv}o_:e3uuevF N>IX;xtʆNYѨV}ׇŪ/JSrl}|JT#qXDvvjNFcwJĶt }nyte6vXxgf$[a>X́kž=Y.( 4|k4uqT{?`ܦm`ZM"V \W܋ pWBa@:\ M\D`k\\'\9' Ta[:=/Cd,,Ƃ*b;CxM81VLm \[EQikM÷1IL[?}v8<_t!84f%5;ʄh_`ic-!Csh=wrl@ nd2ʲ1n@fӛ8St+4!Bx6 y~7e&tlBY+jUAv |[<0׮C>i4Fxu* #x0RDCv`n|׼O G!W-0`f X+?8Y{Mpic)\ը3j,&Xrfv&4?|f1;vܟl{vDG+wǣ{ LjޮBف{^˰pm3evBubkΛ|8^z>2d.͹\˳W ~ITºbuQX{~pd&p|7qmMʳe |T£]pyP*? 륡G'm\=6^[aPQ`> 0z UGP]p$ϼ,EE懚F)H@l]:er)M18;; iOНdxEr@|h_Ǘ*6hl!Tw%J}z7иk[%p"4" AXe2'lr}Q4 wXSt):5]6(V/!@VwSuMb,\nhѺKOvKetSy:,?w2l g21?JyI&$ ?r,E'Ztܪo3剙gEV`MԿg1?oKF7 Z@7p:nL#p :d5`c>IqpC?5!^}O,v6y2o(#?7"~;`@e&cԴzpQBDq185AH>_M}yt}fHn"Wd&{nB@) Atyբ55)a0#vʯ, ATN9/x6zmfF,(Gh8ٺ U9,&>O,JGa*€CB#j=xonS/-Z)7 )Ĩ$W?i H'`V060̤&^JdZ]rꌭ6ͱh[ɕXg4lkv_Ts߿ @lVdf~Moa;3GOws.wЩ3 JVϰt`֮}l1MU^JTaT46m|4>mܯ~%ž1FCL ˊ g4.WUx>B"f+6T" ^k+%Ԗ+fi[Y|=P\9rP2֍@.qn8[ 8+`٢WW iy>~#gבA; %pg`Fp[2\k`F$SFbry0nvh} [(e&lZ3gA}j'u}=c}{ .e/ҥȝB|?$zs .}PKg gX /NN vsֵ>"J Ò 1׏2~l!-8 2DH ‰a@:.@xHhQDͪe6Y?w&AT ~ -G;&9Q2B(W4]#<7?؁@-J!BQ}yVAV+VZʤ^ɔ (Jd½sKU6W:xb[tN]1ĴHlMo-& G DZN(7$ }WN}H H(EMjgP,[:-ҥMe.`|n4[kbY}c~m7 9;VF//176G;jIo)Bg9qٳڜ%٧0G&̶M"kQQr1tuyZn_A(gׄ&ە[Tw2oB@Fp凰2014mieQkNb'fEGZMqYH6 WNiNc=}öo&n֔z_%58m:yV0qX@f0M:L2o~APs g6FM#5_~{rʮJR^?Ou' tFi%ף YƲuast_dBV595&!\_=c"ai@LsRQ`~>?#^LD$`!$%tgD8 Wt`ifDpKU 5yʧgZK#tdd UQ+ʚ`:=0fB"@J/-~(ZYFC[xu@w"XO ZoMC.`'\YP]Z*InCOQ{bߩfQtXl宊dB>}TG\^x 1g%4(GBQHkE#H +AH2G9/]zdOh_ɓkB<(@Bt@DFq#_/:ͷ8TZZukͲקWiL 5 ̏酔uBt.rE>|@Ճ3 "hYi7 'diNF"N z"NZ &/ ԡ?cP./Ѕlvin^w̷;emgmvѧ;y*@/T;j0>Ы:˝zoGGi@?_RT;ͺ͝'A Q"v(6qE nuȣ$@ o3h5)D +-Ha9o])%`.23? sLie)h3vH.7ʠ~7?zAo|w f@ Cs7Im A[.&OSXĻML|$)JnDhF7u{3KkAo؄od➝`D*ޑmd:ޜv:]2e > 2`0F; }~E# l>siX]t>mQObv@ j`v|9ѩXb%5Gcܜg4A G}F}zdSRMi]Iމ4r.["x| JUEL <`0M,}pZ), ZhFlO\`Mã5T\ab(|/̞eGZقp"0.+|eH #򘛬n z8yw}SKN}#{|Z}u Y3 z3>Pz  )7L&H4hxA_'!s^>44bcL5ȷ7\ڠX="md(؄%pzIR@E ,]B+'MYEjYty,Y2Z%7}Qmq%\DYDF?="c.spdaAIκɞM JRS+\t0CLT8 nS!@E1qM{{hKb׶dTJFp}kuf|_u͛;r0HdI,,|.3]*̝056 ̃)҅uy߼R$NZR}@\L} iSW;:`.Bƪl>c=Q6ϵo zr|-Z ۰8ެ]Qښf!9o4(i|ng8m6D 7J#vbAp@Moϻ rx\4D*6D֢.1C(bKbW썇N?G$yNJJ.}X%/&>m ;tvL1~+( u%x\FĐ \Qg@R GoUBlNW$!#@b@.K  A}ԊeLUPJϘ^}T'o=ÃKU<;pprgC$0ܵv\]b&"%ߐPo:1<]N>o;K&|# (ҕ* Tv'MQŸSFU83Sn)"ZSy)χR1Ÿ]xp+ M`-d%!$^}#=7n_׎7Q>YW/03邾F/.AvF7y CI;i?_k8ͺ.O5XppeQE^T!3s#]odlZD {u{'싉IWPfkhݷ&]U\m~׬W _mXSZIUشz>`Km=gV[96&MN:9S~H9LO: F/m E˗ѳJI莐=Ki"Z,3_lN /0HIcu}G muob=zfD.Zp⠌@E1D94a}`9]}-)R"8 +d- N 5R,$C\'t%k5PB"RS仕4,NҦJdns!Zhvg(rrx!ڲ8x"1C* 14;W+dB_m>S '*R҄1k=cZxGQ V-ձ) =Ow+ܻޡH VX42Ƌu`:,DyLc76> OOj+ 5׽̼TIC5-H RX KibM,ICs PCW80+ēNGV(jöeMzHPB"ڑ~Ki_OlA a,^>,E lZHpN,n@JP~V Bj"LpTԸWl>`ljs}?e#կi${hH$#!sNC@9,L|ApZr=KRʻ|n3븜=Õ6qD 6 !c|v%Rrpa  ^O"6 J˰=`+-w}=tfpJME *ͨL 9O@̓Wly~~)Cڃ#H'f'ս%m5";BX$Ż:7Uvn'sU]\s ~s#zu8SK }-ZL=wh6T4eMP9._Q]B%ɈѕW"GMХ2FK~p1Y Ve``B8ABI9˔ܺ@r׵)iz8qPr24-Z? m2 >#_Jtrm g6)?GD 9fC4=C9ȶC)'%[PڡlVpALzǻ ye@)2/9dMLZjf"-ȿwAJ4|ĄfyqZ8׎xx7Gs=+X%d[tm?@^tJ^ĠH }8L(t@8Eb D\~/6W(e [~>`w4U7]Dmyc6N͢>/1γp`f\&^&@$d,^>.*l243ʟ<+[hAmNwMWUW>c @Jx}ZShc/eildp`jeR_ ~ mlDvK[έk L񻣌j+ސt~XPt˹2#&r?Չ'Pj&Z+%k@ J~Ven=i@J0'5ݎj,M^wo<ȐQJV%dEz6M|و}: 9t; ~ O4ooF!6!F~2EF88k@w-C EtUE16,&yd~9[yb'5T@ ^|oϼLq޲y’ xe`԰9 4! (_sr &੊Hgp`3+[QفfDypqH@!U% jxd~t,rxy x4[[BU >ʕEc99J}фẺlW-^{R ͹bPԸv0wڽ|`.pfg:;M<$ VjhW|U@aC,g5%kR$6=AѫWΩ**|gFz ]b[KXyc*,jLE(x.3;`XA[Ԝmdخz E SbH[d# Zb{KD>~,B:@r&ܖy-u-&%贏?Μ?ڵC"lS,zAoʑwh''<`fXa,|jA9z(nt*^)Qm0\jY[ Z$.Zf$QoFZ?ŤuoFhx}ޗbw~mJތZW *K7Xh=9cB O+4 Noh1yS\2KC[AjWwuR$QRn8B1 )nsh[P{/x2"ip׬L8dh<1AFUyԇqES59N9 ^YEwIzjar X0f: A7m_lT飦D yq]RCO 'C_cu>7ɽPmqj-ւCcK:9)zL&:I65`aĭf!5K Y{gd\(,w[>&ɱP$ʝwn{ oY bOQd~z> %dWnD8͋<jgYC-v,Z8d#ID! iC(e.ި@#lgՄ|1wиݽRA|W^ cT)m;pe^(${SŲ*|x[4owH/U0 Clك99uD=e( A@Sx~fV5ba OɚV2AWK'..[*Phxe,z@5n+CHM ߠF00`Wc|3<7CrOVI?!ssU95} WsS9<AL|DnX8_:EX>XqI`11hMS 7|N)ԗH>"h~U\\INRCsu sob67ԺjW2#~U %_ GNp3ID1Y gPE4\~4F0e(SbB85Vl@gQ΃@ࡴ63%Sӎ %6%hhg~w5I03@0BnUz}VT: z"9x7T $`mA ( -Xڍ. ӓ8g:g H c4 +FY5đ'z{w"Gb-KBv5>uodRO)B`N(.Sb]x̱qeYy4q5rㄗBG1<ƂZ`iR6#Aj׾,ֿ%1v1tJ|Ghs[sĀ=k+2glHg({6D4|H~٫Qm1#OK9jgCg*뜞~̧b> Ы+3gX|Us:vvw1Ȟ/ThjXv;-^=DK T˒1K|(C{A$>(jAPm(H')Hp2%)f^MFA$V@ \71&n!LTͧ?nkƝoqK!h!aH[CZ)ZͶ:^Fd K*8~j ̉ *4sio 0[PId5g/cZ8v@f1 ,Yդn)E!} ׷j>u҄0E[d0#Lb р H Xm,oL1,huP1 N&yhp' >4a"Zmdcځy $t4}\nkmYd ;#x^C@d`GcB炿ڕ CF`L,1ԑ?#T??Pj5_VuH?H:Vw{qfn}Z$˦Te4SqgWgH5=rncC&ԩ ޙ#JH"nJ4Q߁:γp!3ذAcE,8:(t9u+I.^ٍlYYIM'4f[۽o]hc7զ@" Rgd5$X;n@H,\.VSHC8@Y@ :^Gٞxe2ÄjqRػFG=]aC ƖXG(W&t[]︮i|9ӗ^^H8 s nήcy;g8mXa&8}rzMΊb  忘(Jq ѷ,{L+Iن)+@1Xc@УkʖGWv׬A 2VuV'zG#|?s."\JtWsЎ҇dV#R8r2WBH ų ^ uipxj{ArbFtav_nGDy=fpNsz^&$WH4)loqV_1{:v`p@Ƞ 4X ?$ӽ3}Ug9nOw( \Rrv JZ )0铿U9ouGqsL_48Y4$);lmn(5{>nDdA.ecU0JO ^E,WdC.=\F37oqJӧd7ȱtĬt BN zDZ4,ۼc{{Z!m^dY…qw1#x s#k<#.@ A',vxɔe|'YVfeB*Fn:DW`K-XߠrY<_M*nP-,er3!)c=.NX Hl VK.1nRs਻}=]IPc2W@ԜgĠԑwmɻ(fG<a/nJu\Pj?[! Xte?n=J/z:w5ѓY-ߵU6йI<_G s)^%fՁ٩,-O@~ )DlqB Bȸ5444%6W /,rXrw=|t?Զ_K}{ d(eur<_҄}zgF`pδ>;c<$cwL [1x%aӴ%&Nix$*șdGէ{MMQ[ 0'!\R+N߸m5ڈoP`ԿTR ۚ p|؋SRة{RX3?f1 ^P`Yc*x5AF}0<ѣj͚ k;&qQ[w3g0y1m)tiҧQZ`0b0 @4)O(@pNb)`Fʉ&)MSg%‹&v{UѺCxDY-Qоhdcc k>k qbM`~ zaoUe +F"4Ϟtv2:Sv]Y1H(g*#G5-`/) xW]I哐T\I:5֑sw'N?c5OEuf Y(F6ZȑA՝ Wɑ7) ۿ#,c+6K=#q- Tstt XU~G_d뒮l*Ҹwid=Nn퓋_/2BH^nKAf[rc'^|s%YϟQ:j]bdԥ*i`M\sǁ!= o4mTa=x|AQ ^NY,l'LǎsmlCe>`B)>5  Sݽ2=+ptA&wqnMA˰*0] *?V"Q CLsxIM;Q%PS0s&ZO:&@"ƶQх!3Bi)g*1@S<Qң|!(HȪ%K~j ϭd)"-pɬb\V2h%QJ}֧>$ ,^][P:~A֗y-~lvQL4'|8s<[,(&i-sG\`vD[X8סtamNUo94$iuK7$ƳaeкN>I.Df[bTpR5@ =F,%+~e+ӈWEJ8K_}6|V^YuF{woLk981*}F-kcqבů;Ǵt7jG:p_ǓB oFBWfT u`z*^ 3F@.}ͺJLYu(R`:q>o'A4\>T@O:C鷕>L̃_-D3"/ztż^Irc^c/^{_"x#= =Cư  succzMX+vokqt;_^=ٕ//R`[tF r c]0؉<tB:ݯOX0CGS`" ꣛(I8$%c- ļ+=""%rd ̨CkA8ճQ H̛ ˳#Z08drؖWG.n4^}o?Vj0 7@!%T1(gxGT'E:Hy<>"}+_נ 7$c fdemQՔ˙tR*?egqIu&ùn؀YR9 X׫2/czz.DЩ>$`2yْXyAǸyR" yK1=OǺ8˲ . \z$F7 ݺ2T v>pd=:gRExYۙ]՚{ ma(Hc)%kt\M&&j8 [Rp`٠{E}gsJzn"Ia>3\2?FSeagFU)<.3\r!u{vqGi,b٘d07[F0:G3ҶY|GoVɁ*Ii6 S3vb0Ŗ>@ VV>MC8t淹:zJ+Z39؀r8Lŝù>4m^A%Sm)0yS.y62k^dWdq H~Or{r"nBQ \aچiK*&b)TcySBY[5'/\$c7 G \Zw;J [^3dT?//KL[.%:?LY" :˜矞8լlg|)[Fqv 0$%UuqRsݭUW :<QW{w!B-xL[/{<ke ѩ <+Uhx__F*gT@ ~cԿ)K[eϹB"uE̝fexTEu: 8 .kaAc?\[M ;}}cNOvh+َ)a),Fu<t] :l˃Ky_/{F@ԑrض./KBU,e]t@+:dPL[ 9me^' jƯ4 x ^\s "q7):`!|m˷7EgeƮo:lHkI3a*9 (MC0NQptY{ĴK'2%:})0BLjiBϵ}'rkxS`C& E:(L~e`-\5Q;8+n~?*9x k$?@lr/;'$ O5 Lhe~JWFUL~{6dg|ᗆjΝ>e3p*~EN0JKn9^ɬ,tC8Av5qa0*C WMl\%37 0Hm6EP#@r֊ck&}鱴5%vrt^%dTy`pxA v͵mh @G\)H=;.PNT)_ݤifWo7dtKo>(1S03Z[28 WUl/tݶ}M :YTWl[.lc $ b[t j`)9kAt(Np-FjG|d@҄K@#ܐ\qw>IHms ۥ ,kWhjFwФhyJj:Y1Lvü%dx_ipq%Axdg4@4(E j p.-5~ ]z.uHRNօ+$\0Oo%lQ͆o?dd{Oc22J%g6/0NLgfS4{|j=vLzA2u8aE*'`=%2 |2/( -!]N9{(NT b[EAj~"٩'Q;68Gkv%ï=S6(`qַv6t2R')%eV:U|R=MO h$H sv.IfB(YE~<ӄYE`c KB#Vt+sZM;Fj]~+S=YX=@%} mݑEg;H{[-;sLO@e=%/ŽiZnӕ! Lf%54JݓzPE]ZOuj[OTbN$) cG>? r"!Us\urfpIl$ 2ٍXX8O"qi nP%L.:݆݅[[r& W#^6Q48I]dwf) 16h,H`$a1LNnxv[lZgAT7n#H <퉓cM0a9b&6cFbt+ QV NAP9T~k5.Fт*q-ZTv:*LYO.^@bF_/ѷ`"dn$v;_W!nKfi_XDz1X9Qp]y9)7Y@8#03mQ[w%WdԒ6ÓXթӰ̔ڊ;sd1JRN۶MlUzh`8Qkr(4p @?JJ"pbț'`^N7 ]Zm)7f}$-ك0M@g.@ :p6 )|ya3r-!=hcRVZN[KtS݋DL^?ܳ5{w zSee;u1 Y NTaMJT\,5+oC-GjU&ʾE5a"l@ʜ9D9QvVO_rH\;.[O;]7onspJAp=Aґyv(M!}\>w ?Tg襝(_hιVD+K2`ՒkVupTg F_K#\6Wu賅Hw7-7MBtؕis;x]3TκLNHI1̦ u`s/g=G̵N?/4~$ a͋ǟ~!SGVYȕW4lqg篓Ri6rVOUjiS4:w}^JwWrN5xwp-Oy!)CܶРѡk/]YVB]trn4*gzDGO?!oiKuu(-5D%sv1nfD) WO^/~1l0mzS/4yכho]-fp$` \6AAǣ#Zqn' @X#eex W';/uW;ohXd+>SdG6밙NIIခM*IF-rX Qt!AKB:=!K9藠y$c'DŽD6&ct<#9v-|pi\npP9,"_J+>"Og C^8ӔwF `޽ڮ/9 塛vc\lF lO#RJ–(MJ#+2A8̓>`ڕhm|Uh1OM+i|nK p~ [", 1M'4TL[^t`(sJ 'MWB옷Ö +tm-Ff5a ^S` fgχqb)2ְ<>nS q  #5c>`Ԯm5†g;5;xɷhCH80LKHM!S";)g&43q hKYnfqŽµ4њ|Vkqu`ZSј`ofПasnI8(ފjL#$`g66:^R((ȪJ1 1OQW)! -8@ ;Ħ5EB04G>Zu곴Zyf,:Q IV P%Z nuV!-!dp9QPe2DA"0zx94eLVOjYqM2rQ/80T)AL;$QEZte])-$oAp/>F1Ͳo+KFÁiջJV8c_sF4 ebd!wRO64xҜ8}Oқ pMALZ]C%t|ZnoN }r~-'qѡ#U<!$%sP M!C)=ĢD\n}<3)W?4MZ}}iݝ? N8yweΒ/>!kGZzs\CzYF,ŠԶW>|/f#˦Mf&x,AгEAp;j[V :^fs`0$Z9Ӄqsq.mX;:u ^(nL9K " g獂lZbb  N2bj aۋl, iJ ; &9X.RVTČ>n' 00)u˴:<$Zl/+ 0vI#[ K}܋BEmKVhjaT i陁@ɁTWf@:A!HE  \.(kAGf"=vL˩nRFY0  oOB*c-jBmr )W}DL0*qX@f{IU_0o`uOKM 7y8L( Syէ"w۵`Ev-pY[Mj{j/<@NO >f~$mn%(J',6g}MR] L>vy0*AzUSJN$Lhqej쟖Bu*SL얘AVgjL =)mMmFl*vs63dXb*KчFgokeoGod GISv<_λ N>߫:Ǩ~*ͬ؎=alc+AiYMN}˼ ⁄1&-\2uc/'zSUhMP31qP&mճUC{G#qaM`!Gl0 ^cL# !@`y R#J+vo慺&=]$ㅡ (dml'"YUÐLjg(T prsW,= cdiӋIfTp`zckqCJ nG82le4K`g^IEoފr`n9lNҰS R۝fa_ bh Jr A%葛}G Q⩵ImK<ɜt:?)o%̛>yѼ+Uwm3>.aћXݿU|`xmEXbJvrtFHrϨnÉ)B7>쐅)ea3s]7}W¬A.vZ+1 f@k@RA1/AD,!fJBo639ߊͤBcgm } VHhCiULƸU@י(t .= h,@޻|]z0Jb 1V&Ťw3d ZU4!~4(31961 E=Tݬ砰dfš o$3LkF<ºt&7iҙTyP$bewXfe}b4}sVEiBY9#u4l\cB584\|LjG2n{U2md̟3=& HPF,k=֦ỵ;+xі>+D ΦDak ~j 0Tm+{C<\Xp`Hs˪hچHƴekY [8=b.2P.aW Tb?f Q*i  ! `3@Asi:,o7k-K%MflCFQV2j=('/B0IS2*g>뾎)|&.pV%ZT,!B9kX^40̴Ԗ0&"VǘG?VhiANiJ: @P2sQ.O*TH;0$2D nt-%UOZzNu uR^r߁cEyfxC9zKظu&N|@..(ٌtx۶T= ]֖7a̧P͒d3߶Uf.s!kA DX CUnaoK=\Тb=rQf4Ĭ/›+I,@UZl[TΛᖿ . %g'ٳjvH*l/[YSiHw$܋?r佼g50 ;A6"Rq٫Jlإ6njv&dIa@l9ԷeS 2bI:I xAl: ޳2Z7FtSA-P<􂧨: Fs wAv.SyReYQ'%,=T9vk McI2Eh\ERlF(]']uPĥȞD|O6#iYQێ0_/KM}X^|WVb9Z-hno$غ83 #!{".65) ʊa= rNf8Y&pMͺc8 ܡUi0]ف~`3bq bl!zetkB_@;Xt4qʙP#Fc?M*峏:[9^3GC6O`yޙh_'k֣BbMW~WA̍Vwi ָ8M7WB?)5,`,'6*Q+w _·}+ @Ddc{u> XUe.\L_Fcqfݜ)T|ПS5~OY4Ɣ X ~ы)|:GZ)[٬/DT\5;#-랍W\e1&p(xF6巩E y z7T(sht<s愃bGVK˝qk2JLۈfهaMEx`ڃh"IRXQHʙvQ\I%e|ȎN\ns+[Jۋ te:Llg)0yJ+)/xlT0yȉҶ2.QH V4n!06ʧ]4bj҆ŵFiBdQL;%9( P?Tje% 6|Tp+tLzKSW 7nmf+asnLdJHf'R: }Է&6pe-fe:u|6S'` #2Z@zD4!;4ž% XH31챱OJ#30J<&ѳ 8 WW?98O JRLEG1Րl%GhɤXOfy6j9SNY6 =  Mu^NVm d?|oeb͈ӴXb[Ӛ+is cA?+u  iWY`$$v6v6*3M;*fN*@D`5Q0Bg6@Fz <>XаҸ/PA 8ACJ P]O2+U@]MxpsbqcӖ63/AhHڜ{3A`ߒ!ЬBy fGC[ġ:(!૮4PCW4 7C>n h7@c=rӕh9jttqSuzM1jċo-TjhtNk8t3 O5w(U7ql\0@@ k N Sokx9 Uq۵Re(!JFoj3vU6<NjdCw4qt)zl x6ilMEİGTScr B&]ymBr;-οw T6O;"uJDbgF &sU{^C %pF 2(D Ѽg$"4 Άu!0gAXs_CMCl`Fj\BNd!:.,6?zABFe^̄ݵ };}pOcuF |\8;h>T3 ݛ?6GOMGKSlTD"*`pƀ_؋aÃAvPy(^$ 舏7bp& @,Rs4nPsa>ip4ABN WkS)YkLH0+9s8 ǘ|r0r6uujTJ$I$=Sr&?{Sogks?\xm6;l]ήck^S&Y|Ou<"5rpxvy)>uH@  $  tHE4Bł;<<zao|`?dPdBp4hKr p Ě2`!K( riOe &ͣNc?;쓠 /pkчf, .gj-}ړN,|Xod.}!V! %.p0aN{&')Z0ZYn>/?#D6腌B͇B&-a„BvUx|#jF/}s㏰i) spo9rĪHHo]O's-rM9ۛȌ?O=JsT%t % XLtS`uVVAjNh`d-ِwF]C13v+:Df 2Ktfa)cLo:mh"(h{>r/}tv\:CxqWKԎ((9MӉ > `&BK?NP8p@ꢊ TDQq|}Ng:[^Z.h>7)1Z"q RBBJ;'ib˚vЩ fʒ0olS)~@Rг3ge~6YD3XYAadڽm:* ui!\3 !/&xsp*!&}I+=6"i|w-@:Nw BSi&޳rEWl[O@GA~=nWhp^~f,mגLJ5"s%UWP75AaNdzY1Jܤx1GqaRM桜DhS ^b2,zm] |q#dlk}wu뻽//sFnf'`AsI2+Vw_Cs*7E_\q44֣=X@X](y7 9je.BOsg:wBuJdv .;b#tXQAOp=7A@Z zדXLqMn!-iT^,O|SHs~HGA=Nr87}}稫;OvLeTmT|FT{ Mnn NYM^MzQ8 R&&օ7oNrxvT@SeصTsTw_Wxt;v?~?]<\l)ﾅPC x"Myn;.JO|` i/қ<,rB t]tVz,  ! ];|U@*h|z #kUD8W~*4k~ǫo*2V'cDE5s6;>='_멙 r @P=L@@@,"s=[EC)! "H0IO !YBo}$@TT[_c_qȨv=Wi@/U>t CDD8z3E^_Ti 6^no*=w`Q("=?ܰAQs kD^AVz^kФRoh%|Ӆ´*&NΈDNb91D*@]W("x9-ֲ9*|{R+^Z=t|Oo5>yh"޷U{kj>v"z}3*f:ȡ`z[v9V6Eʃ`st} {&eA;X9W~6;)@^6=OA1YP0IJ.PN_;@:+HmoqDt~Ov\=XvtaPC7(}O_@]E8cè?S^˻5W=)<繳sAN㪿P6-hn+Dz O8fd^qowj !!0Gl9 ڷW859gUyM{yvҥe@Imy=9[͞穊wtWW׻D+p@֧l՞@G$!rdi)H;0%xk2%/ 55r1>S@&ziU<YN%ap5S]q: m1 \+J&};4奖>bz)I*!)IJLˢ*H'72pj0fUasBS'|`'ĀH4~\u O5ZƣGޠf#e u8|MIچAp@o`P{w6~=Agk*Ȩ ڌ N5ⴓio?2GU|Bni;eОC,TLt=څ^:7:- 1X÷|Ţc,j +xQ@I`Q@ny܀-ÿEzfqz @\ #\= ї+XF/4Oip#!-#0M-^Э#">ƝPx]cf} ;uv(}n|mUI\\g,V`ŚPjJH F`~ xh]d^ˉ&t]u%m=Қ?kJ_dLH+,0&:!ZC 2(d}cvi0 D!`>YAD5b N#K EwQb_ ~xܥo=oʡr+DdGD=P %`3OG*S߁耜kUSiǛ//OdPɞ4 P"ꨘw1xV )HȠ]Xy t"* f&<@3bD6qAS{RPKk*eUb%}"t0Ŕ?+_E+->gnP:IdCy kb%7*u(E\Vh")"r 3?A,H)XtDPxqG]P|)4DAVbCy [ت90UqU|PN Ȃ|b6$( XgR۔Š   N" 8 QTt4%(02(_P@Pi Ƃ71} /G@v_b!OIO|Da=Ḏ,ƏA>Dt@I_iYQQUyȨgT$UiD^-E)DLXH6b"5 ~ X'g4Vܪ! @0:@EiJp!X$7"S#DUs*`(C?BU@-+ǂA=dS? -d  rbk a?_r.,&hjnڳ,pܦ ,꩹a /͟}$OUжR?Ͼu/k[}w6h/EM\P9QACyx #O#DUd(hb"(\@( (T DER }ب#Ib sǀPA@;( )"rTA7ʂ(" ,{(XQnQ$ADmTΊPz=[ 'a3 wϓ~7 ( hbC33)z zyY菄D>DO[D&"TJDH(uq(-RVB1~P꘍@( FhY-GQ6%8~-kQ'ms)<_o@D(3vByJ UL@< 3 w2h.D1R(cB} SAt@w=6/@~vxz_v(H'_|[/s O7:$Ku>rgqCĝB3 ѩ`}-$GK)av:Pm`sYJ^ hc@:}o]WD%r*9P}Az8w0ŀswY-$}/!fr&<7O{WgSGĨ/AǃsZqnb 3L" yh-_DC9T@T<*?oSHAz/'ݚH}D%&{uzĪkZ4ׅ4>^#I1gEu|Zd8j?kX5<OOܺ<+U!4j0!k 'qzkYE]'@o$Ί*hJuNF Κ8# -kM+.E\@ pUp _B Az*a/C D"e(E/;X('(90P@"މ@1EWQ]$|xj!d(yk(%ƂIV ]+Fl\6ܸw$ZR €"" z @0@Nv( D51D7#>vup笣QNVϊWbf)T=l< M4:gLG&˴2j{)("~\A O' w3A6;= |no?`"㊀ 5s 3Y)\A^cUQop(xU6zshX[Ka0SҞSmB=(@͙0B/Jm fDUj8T"=`h!}C۪4d(7QHH Dpibfu3O7zOnQfM\~O{ Ƞ8_޻ - Ij,(YS#Wu5 x-IP%m(]URG-KJ*@D8]30qϢ怇}6P#!~DQ`]Qc(qD$ijbhȧ+QEC(ފP"b"'C@- b+͏Ĉ}8 3U r ibȭOSQ3H"(fy]@NJl95 Ey61k *z" jϚGgTO&)I&xArg7Ŋ_'dASEE^.Ґ_lBw)@?(  `OmC°L/gf~IH@0D#>z#r_C{x=/Eκ_|~{W;il:飘A")SM.C61y{(̈S^`v_C{" W+ܯNVzhJ( U@TD#SgD󷘛:hʠiq;MG?2+D>WK6j`0BidM#1-ggUU㩌¢)j: ttwjFH1Fɗ=@ģBzx4s"YIA=P)?<A b'1?@9-O8s*}H41NƠ3V)H"h:dGCZ*)sTü '<;+}°8pOK0Ĉ6tdIf'G2(|L+aɍ;H&Ae{y͢gSOT) G; Vҁ/ =wlj SQ2itwMC<{ߣMM\"&Hi` (]>-膊zXt*ɂ<}M);8A2'3Vƺ"B/iᩛlܗwˠ}ZC^677{_SU­F}^ZWcO9cx]#OS uoAɚϹ)GO0䝜QRMHHI8)@"+z6EQ9OUOt;//^56,E5U }MNjK @QJ`'TUR#@XPJ MbF  PiA3e z!C U"4+TkIC%A)ɨhAJumZha׀j[XP!eP,"e^IׇmֲQe0 Qf{vkW,]B $   X!h0shER PNYiqBIvI.Q-ZKY7TN@`oWC6Kbح.EcOZB \Y@RJ d^jlvHū&{[򱵔 /2P BTbuur`0DIeRxuR,%\墡bTU.<\q:.p#\vMu}|jҼa+kI5Yҩ f!k0hXS' j+B-z}" ^[{O$BTpDd;lfO%^1 oEʫQ|*v1 D褬zY#+ ;[<˱nW ʡw`9Il u}1*Mir-N8Zͷpy/Wƾk2=/ywPơ!=_8G'9:!puI˲+Ķ"ɫ<5KjU_^pڮ`(?N*{ ,@E71N~=?Lt;M$*HHg Nu[E!4t#ňP3z[Pġ\8 (9B<w(D+kKXC/A'3ҳQ~qN?Pc H1 lYH|Z0@iIJn>*}70&֟`AT'Bi!S\>+w qʭ) Yc)T,aXMԼ@(WfۏY|, м+;LM{j Yl ޛW9{NQN ?RR!c6Z1ZdhvUVzO,@A$bCF>wlx/%V.Bmw$GZE7L$UbPajsۜ5Z;b eB‡ZVZVH]нLcD0>Qj@Ŵ# QWS"3 upF^ &z'9=,.1f_5J1Zƒ5A{iٜXqp-Uj\p ͼGkyjm&j_27.fMAbR*_ULL눷EkiN c+rx ٽ2ilӉr&ăa=U<<{H$q7lJchA dNdRHwkIwo5'PAEUώJSkTlQ:3ӘDAT+A-:xD!Vf(; t40Z!8.UJ3#&)JL\p]NepG@xb$U Ԃ`Ye@XL|˾p'.0TD %Pe[luwjWFKW^} VluD#|0d(g,,bU"LD @(bO ]"[X⊙!r)6:vvqXkPPP+-$V4bʝ% khMhp1Fiu*W S]qs2N.sjC: @`DbO*̶JXV%yfTM%P@P.^( ?)AMkKj+Uҧ)Ghl =9,]⬽.kUyK(\.q|BvP< tnTiӒA#U(9xЅX(ͯ;(9Dr4R3A1ԬE&ЁH!Tb ^%,6\FӅ0 MYno/$ M]EF %XPPy"LA8!-~GWNr|YqEГye"N+'(34`ɭ+ FTnV)DGŎVu}E{Z7^W=_1%V&ܾ sJ4U>!w_y{al(0{75PC~u*l`P[E6@8V[)c)r1lؑ- IN!vT("hV\:+NF&swY#S'D-abɊv-S(YZ*u% feMUL?k$iC?{K `\CXX0"y!D.VōUjZޓ[U5ͫbmDR !d ǚԴYy簿|-7ƆkcN JN(@<ǟTDa_",E)&2Rc4욪$siϸXY@ؖQMum*<ڨve)To x Dz2n,ci^)ʲ2 rVf{UX8gQ;HB jJoS!r k!d.iAh4uzOst}nnaڼ3c7?Zң\JN .5qHA:J>Lpc8 y&8wK3DZ Th&.chWLi_hDيƔAXܵj4hf']"|#v_7%D, yRrX_^@"wb!$nux0onAu"5W`"Q8 ;zb`d::w**MD3HrEn-Q4TkV54bѬQhhJm5]^g;v6,&TclQkN%:H#抮/4[@S,CC@ "zJܞ )DJQyyNN8rNm/t$ދrW|ʻ|KUMxhX͵,A 2KgK? )P8/76jc\#6=J;|5L!"/0)E@KƼ8.a%^0*H@c>&QZ^1]YZ $mE=`8R.G^8nht$+qE6uaDfqgb l"5Q@0DΠZ ,kX`t]PZ%:F]a$4@ ,UR0~9PUj 1%ƣ B$6 Wk(AUJ|>1d)A*Pq0IYE@A3Ms>ב)[S8B@ô!"*"Lհ ߁CPVe  E) !8Vh,ܥEg9^{ku7< 9b*M&HX$B;~ʺݚId&ck,TX cbЖlX3 dux<9ku:I8Ex=ռz}\9Îd_8n@1&9v֗ $.9/6 `V:(1 Rא1m %K+KHݮcU]n]lRmKI*BnK뻯UMD,.*~jf}m xd\|I c`. ͫ\u`lUYtj1*kc&dѮ뷃]G9Ę*Haq9˳uͨ-kVI%j $r:%f$+-iIH(A#\~TWR2 *o5nbxzwmy.Dc75la3aBKJY ZQijUK k=o+.d50N,ADPQxnB2H}QA@UA "R?RR #50}[S1YÑ7gFf6տ?<~rMZЕ߇@ ×_DiL0UۇEuCm2Ki@,\X9;aC3dTa d/. Q{E`~3/QF$y܏yVn; V]ii?Ҋ} yq^Q3k@VJI.-%-rOx\ʑYNk6h豵;Cs/J1FD>Q\/VGh&\zQ$NJ:Aت&<$Fr,#kQkxVWV#ئW~\6k[j5^&Rdj`޷幺h3v^w\XH}7L0 }--ƮEkGWT*OS=Sc%a=wnLZkLw:+zʎ)0$8Ҙ̰!Nf4i^`O=J=)$8iQP @$ͷeY+[9i-њY-P5J:U@38Ҩbk3Îu싸ʲs@Y2Fjۛ`+s2bH{cԖ\q|> w,P4ұ_p]>g-]etʊd*zQ~O 46fڅHFAip!!(FEVBEf]3wKi<xZ 6 e&7e$dZYVK^kWx\# H؋%9q's$-ǿ7/)M[DU+Wj:wՒLp IsQ{9m_b BCE99RB9փ](lAU(VvF(s1 ATL0C*`Vu)1rZFGDy4ID $SzAOJ$Ttpi4h2v`q" !2k>o6TB"x?{`y+2AJnA!glAHvI@4#rC(ݷ ~mIgߔidf:2bej"Y1+/b 8!=^Kho*bݳKw0FBx٥!e*Db=K\qMpc.%g#C4UfE-贶-4):۪6A)KPX\hjIi뢇)?,Y("H7'*mص#D)zA+!H_lՑyD11U"D;22Qp;O{@Β&A׵"%I~7yI9 1AXTUXXJ_UdxđQqCW|P{}Mv:< :#S罧s#qױ,c)1_;k qsWܬ9DH6% 2H \Idc;[)iÆCNG7/|_2ŝLlu kc4H٨LdI=Ffc,ĭtZ)a~$Sj&䨦+u%'J3Mފ m*PkUj@X0UcSHfC.BL#OJRy٠QDD+zfJXS,Vf!f+룽^т哘ӵ wЋ_C#m`RS1^6D~CMj$#d^ȋiWޗFܞb5D*/VEf{׭qHv 92EKi4Z$3ei:`o y ygfw,X!G8c3*OaQ93sxJ2 ` izX<*y1S ie#,m2vfMT k0d[m bZ򷟐ݰ8sR{Pl,q"@ ?ld#Or4< 6M7\+-$5XZ4c{j2eUf)_H6fE?va/GbӁ?>w1)1 0phZ\6V;<<&4_&BjSs4 P%0̈́Cڍc>G6 G'7=c+-ٛ1)>n  7vĿҖ^L|@^ 9:U[4aHnp{i %Ղs2juF6ǥ̪cиyET5 <_$ ( Cy? ;5:*/?CZ-Nz)!6| Y=.gf!<)EqW}L N&7k|q'$KfY#'7DOMTDrREyҲ˴Ʈ!"f7}=I5vMX")G?b,dp-$*R pTg d/V„IFyG>og2^@@joM2FSIJ2`1g3Z+,Ӕ-3ni0̦5tW%95a)d'*PgEɜl(nM6(&H ) 2(V"e؀bDtE *Fi_PVELQ^@])YXHh D af-m4@6 m/ ) )*6:*~1׸.¨UE:{$ȓ(P P.Y@IlS\2K@4-n㜽-T-kb^ x|"HŤP*n{I $L훻JmmL-pXKLnq^WӪzᇹF?u^"s { HZRܫ̇ݪ $)/,W7jE/W0\zOPڎ'{_=_#uGdCV4KBQt[z>Kࡳ Qyj lǠP+Jipm(P3&p蘐SsڪUDN:&{117\ 1 WaV/먗h' T-vQ; 29ւ ՛<0g:qbQDQ 1Aqq(r",`b hh JD".dGGD4 KT!j/}D 8kK?j+A|[- pV"p.%,C6/ ]c5 K:c TNkl}*jtAl#!  P5}6kTN=QLPwWdmwby'Sz`> xdʵϳ^#Pּl6qA 8/H3Ym:l:GHq =* "jT>Vpf :r=FӃuY\RoqjWm*gP]hW-츬[:Gb2u{}Lyz)Ґ%Tt m4kzwܴE*;y/l%?ok]@ccW;^ [/euj5QE]mjx={<=\΅ͬ_qmm[T.DĔ >ȁ -U{mAo`^vyYUp4.pX, @䪐<\]8jHiWۙpCP$*+8(aNR*uQD,AG!40S2!v(H ֣uW-~^s^>mWDktƤKQW[>.29[OBHWѫ{-kuۥx>Kp~_U$KHGW<3͵EJ/g D$PVóc+!ZYnZS..~Eaت))%au {XK$ू B_Lh)%@<=~5,[zƆ, 'ɲlR/Q θjU0 c%KԕeyK&K*qs)kt$M,A &Qz|hF 9nW4Ecǂ~c\4IwD&zz3(YeU,)dw/nIYZ 7bS&kHe'ov۵' @׳4{~$GВzaAe] Ƀ_KSD:MFAz[Q⫱QL*L*;2QOOÀ%٧IjziNW:=Gr 7_q_o2)u&=j-$*̽`^ʦ"=UEޢ>~`N<=ڗ!@ȟ1nvMKN%D32`7g@- >(z'H\(]I^ CqVOf~QKʁI${Ŷeb]:s<ޟ 1UD\ao_ %0#$f٪ᡨ@w?N3ӷKbB=(]4P_yM<@BH;=vާg7qOju>.n,o L(#8Zsvθ rݛ.z4`Ϛߺ M0khZnĻϿs[(й:mf SA:r; mq% M v-, m_8߻i~;뿻C]grᢿRU$P> n6)p BWs:cȧQٗxosYI13|locߝeR%HֈO*@"1qCrnxU-b07D@򹪈 W̶gIeL{%pC 4uj]G+#zVׯБ7|z q ^ѪX|;SXGof6mMt#/Ӱz/$4325 IމYxwlF)?{aa{b:.Ϋ>{3{F7}콧D>ȣ;FNyK0},(,HNFזP;Dp]̾}Nnh]-r{毌~)B͢,[l.f7oN;ӒB'|3V766c< ^黯NZKM.P>?Lj7~YMnk ixL%JPpѮq٘tc2-8:ʂIRg;8ֆW_wN ،\P̂K/ TZ7QyuU |Ơ,1ox8 GQv+eJA";O3惲 {d2gPDdoDKĚrQ@ +i 7[nP.3ǫ׋}<@Z%Eg!i`meJfnjqèP@)IBWTrŐ e\ȥޚ]b[1J>%Oj_RhGOE1 2L'4ﳞGqһHs8>6"f5dH_b6ƫ1,p#Sfy'`ʱ9x2VC8Vv8]C7b$r'>G(49^2,GK~Χ$  Zkwi =3 (nko=TA/X!koBZYK1 $&}V(zs;aneCۘ+D3mXOj/7o/lwMmś~Yad]b[n[G;k[t[BH{ynv#ݺt[@㗮VR} 9 夅Δ^MWaISmkyӂj5\) V%K̃i+P_8WN݌X[,&;Щɓ[H2Vo%@²-ZջDVCk ?/ꡠ׭EwmC VYCkTFRAJ[%hڮTI@XǻOp0xMMxNWy%#&AY!bTʕ"{ K'{Xob\vLDOh_aUr4Q 0F*E؎a|@3c 'RXXy!bBL֍J4Sơo\5Q0n]q?[,n@ ݲ|CG=~ Ck~d('!g惤Β" Zҥ@Ek2EI|խTj-R7p0 R@2e6 )_kVNl,(23iqdކT*bG%N XO:",p:LYł %DF%0`WhU_R H+::jC~nc`Yi*8l M5m܊SwB(=Ȗ_eWmY=f[Ú'6(~Sk Nyc_:u.7#Bn0Xe0?& cnk>p |7+>]J,j[eleTݳYEs=ES8$[)RBE C&(PQ80oS\0Z+KU0(M <^Oe|O#{[9${>&xƙ>C:w\E:;C.?w=z7,x*&\$4Ӈwgl~6>?";UYCEgu5.UpW<؀q )7cd/YԦ]_U7?2&yc)s) (=3UP9ȣ ASNØC'_oNŤ?L Cg4x2+-.)([[ uWv <"G?!H=+eJ#riIVcYFH%4z\ okz| n9Z<5X1HWeo&3XhP@Hzb]N} ^ĖUDڦs,gj8'xe`U&|w( XXg j˳Q$XsOikԫ<ֹBE9V6) ne 9p rY<5F0dq5C 䆴IvdNzÅ=^T* Kb=FCH \ <61[: aS?`b^ )U˗aUI(h驦\,Txǖy[k< |yX!"u>_Qڗ뮅PJ Itpۧd; Y[<:8(z-g۔<}392OMw0}l GMBckqqF,I\Di:# -9 ͢|JФ 4I뫹G~ 6.˯=h24.-J[WQ!h [c;&ac8ٻ1mB@YA"IA.]i f̄ui@Ur405<(Dˬif,ʪ#DCd5⢾T,@DO8f%R kv} RJ g\V(I:jʝe;LaP;ڥi;M+f4 $K bp\XT]YX$ep7nEw|¥o3wEeP ┰E.DgޥPEnzDpFkPZ*Ɉ&΁ ΗCIlWE sWDuFAisGAn"{YUG=%t6 zssdzQ<CD.,h*!7}S?}rvtwuSw¢9QpJHCyʞ0]6^>ۻ}QdZ; %0#VJ W6^t/(MuVd#THo%jqͦ&{q?Hi~:&k|j(Y/ϸu O7^Pc`e.tδ`7G)[d!!0ďyR:ɟ!EJ@ 1@ * 2")Gd$+G zKPe̢%v.5`rAZf<O #ysfeZ-;l,=+|ͅJxS&iIv)ŢuoAONsno{ZgS]wwpuHD ti #-\&sɊ( VٽEnzu@^i_jנRdW8IwYp֫B$^URƃ˭m* I틥T1*N\,\Gzܪڡ HCoa}Eܔ,]az;C忚!c(bÁN?-ʖu:-UU#CBP5-EހfғI P·anU)P1HFk rʌ 'LTF +T+qVlG&PoNs $9;ꕫ'+eFDMˍϜd|G+tj~PhRv ^` 2|v3G/S4Ӯ)~s'd_ ⚃- G)nZ1JG|EVfKUdkYBrc)0>D[-A 8i?m?Dbi9Uzcqڐ'lša=R*a0 1;كE`Th򕫄bH%)47YD{w6U^IQM)LxNm8Wj!APFgAQ@{k{fjш+c4^3Km+عK;sYcy'k]nR-@yߊy4j|?@ӨRYːhD]~ @sŒrR;<@@P.nA=zt#!BxlePZdt$X$[VC0G1ߚ@%K/q\ ge9wC( Aҽg Ql0 sBs ?x;@PclV#F$dd˼=gE Ly@6s( Z4VKb_k{&?Qb.A D,O)x:)T!bD^oTȄ>CȲeg2on!%`'Z=۠˔%.{gubS\ШK ҂Ɇ5o,/GM:/LְّGGCOۃwIBБ4S:o73t\i+! br1sZ^f%C?r[Ω=>gKΧ|ٟƆo6_g`5l6T6kt C 10]{RYۆ#+`1o[ Xe9,9\.ݠJlQaB4 |7E I23y'.ڕ*|xErVjF5 ĻQeG@p> S;(* +M߄j<#zNxfm%uK_6[Z RE$ @ FeTGu`[+;=\#|kIqԶ?*So}>v0|ߟ1>JiطJTڪVQλ'6kO[}-P?~י=VZQy\؈vup,%![i:Z7(ʑ;+D}J-I:N3(Γ A>/^@G &DA@1UbjP+(Ÿ>ɃPnd(J9@ b+eVv)S- ]7&9[Q5#jd(2?vuweb`*}$_J@1?p(M;D "\9 4rՒd.d'ϳ氟ʨѭHZ;%y7)Ld1)!,7Ar" 0EVSwT3ӗF\Qɉ`,$=DcIЪP2Np0sȒشTݬp. F =~.!y-UX"lum4u }t^`2IWlEJr1 Ũ$ };hUS(E=ʭX[b@Ѭpq䋼sR'εyt@J4jVH,vZJV&+Ce$o0$GJ@?<5x֩b{=5k4*lv2cЌFCcSkƔerD)R81pݻ?, >[&aݷF3"BO~tD2 a/sdKl}gq ӡkк1H~U~CJ_3CQu^î3XQ/?b M$ID}i,';وi(&z$>or YQd:F(v էѨtlJ0 F/P/ G0YX7Ohw5-x $@3X>Go06NnDM5a ;@AC~5f?v&<嵫:H2f\ Iv~ۆv7PcJNk Lzl쵸 a ! ^+om %LLUt^MƓrWeSTDsIsۣY8m<Ij ƟfH xl<#r;uǪkT?[6We[(r>D* 0xEv*} +` 99:W&Qg?A7V俶7-yz(?ʀߙ= x ydڮL%ۓ~&t<4}m("XK D^ Av~ނ%q" l\DBP @ W.rLG@!!U-d\QW5 I\+\+/,29p ^dx [TPvn-fl(l@CK>|~Q8O'[$Muv_;AT׭Cg?<*/>flڒcXBL<D3LFx#yni_ ** ;ErT}uwkONZĬoJOisM6w)X>6v;뤓7T3:d q+Q2WO EbN* Gf_4FWY,i9~{v&"j`SQ6BS |ٱ+?͜$}~~&A@Y,`VyDo6p+ )kgǶndd C&E>IBPWt_2OP"u + /lV@0_8­۳>)1Q>ֵ3Ƅk+P%}n.Ǭ0]<6fL4W ].l@eX@DV6E3QI H=tV٠h iOA[ֵ#̀Ao0hJp 뉸 <2~c{cJ *,R$lL Q$HmS^X_8xak]sSY4 .R( qe%@훰P᫊꡹Q! 7:ݵP?ܸ߀q2PEfD@E?r!.ӂA1H20j =iۢ$ wYK3۫omĠ}9@M"c5Zq@|T?4nW:TE҈>)D@<,R>5ّ[%2F!OyNNXdHENIeBA'Ǘ0ddLӭk- C!\/?Dz||=E/U)* w@ =$ME"e&&IDdzEK @T#vIq <ͧudZ&g5R'f>Lj] eWӲyV&Zo46{ J}?,WaI@h5PV B1 @/bC>_;'<Ǝ3̇ʤ@e @H ( m-'õVaRL- T[*6X?qNl{ll)$ %@j Wl!> )}Ok?gJe"CgUB~)Q*xz^!?Ҙ~IdYXMu'?qy ӕAGvycm@?Y ^rGՀEQ ; E2ok4[aE$K3`ksm.leB=l_ r/MB8L &-0sH@*UYa#%\ LOdHp}t -e}L/Ʊ?>ΦH ,_7>!oxlþ*+>a(vƮZẒ{ 6PQF)/@ BU$kIC+N֯Qt ^fRxʴ2ǒ˳>_v6~Skԡ @bB*cJ@(Z+.?Kgų\%g3ç-f\6kJ_j!oQOyESb<էEC!;,. u y,:.}@b JMRc\Pjc (ȯCt85)8oo?AꯏI{PAݺ BTxNo,wnb^a5UVf`PF Gt28lIN ?`XG\B1=B#ϬƖ܍@DDt9DH_S}~ݿ)sqs1ҳ՞wuQ5X#LNZeömuuU7q"]F- ys~lO~sؑ bks$j,:g]ÅP& ^yVT9 2xիϴ#dV$kLwZӔ\mMlŭn;}S0C~=adY(D_AYM1l'=[ b(ψ_<οˠsNbTM}Iv7}Z“:̚"bcP &RbUِaoeMMxڨDz_HB ]Gɛk-~36.d?Ue&%It%O-GẴr ╃^J./0vћ4ucXwM;RNMvL.FpzַQTÛYyP}jCuT1WڲS#hi 8GOQ#?0WfdPC" ~e)̻=AW* #Kok}syC|NI=?ke1羞OJҵHA/e$ W_)O6,j->'|{oEnZ4~T']1TD.p=h)!R^^!Ȟ1(flE%@q&ȑQ(DF C<OCw7ݼ5ˆGPQYM5gBߨN@D*[=% hDxuFw<5)MELEAIs'.x\帽xyXc; Z@0Wƨ<}55U9?G掼le.1W/"-C_\Wn0!RI9& BxnY`RzW'3;ó %ibw5:XLgybR7P(U k9 @P~?Е(MyB:J*ޝ::wku9{%wmP]8H'=MX|+4ߏ] 7X9gGM4VT]͋n8ԦHyЂ&OPvG۹Zz@ (?в"550=˹v_x2s"27(z:S&}s]Y\2B[{ն3 sDDrJz҈5Ѓ@fVm:[ ʏ'P3}[ g^#-g&ҤZ ^KUw#d }h(Ng\j~+⋘{י^gnj'D8ZW҅x/q+OG+~V5"śG,=3,U*[8#oK,wֺ*zO+eLGYM2guxdmh׳),?yߵsq`w~k o"wugޏ.C}Ϋpnéɭz !=ZVD{&90zzI2P]Qhank(R~ZH%9P1 4f1G!EAA@h1N@gvsӪS>,J2g?oMJ3 Ry yG5XzԺ)4L!S۔Q̪Y㓺~n: mHڅEݐ @ ``5~*3"ͭ9$H-CanS*fnpߢ uׇV<dI Z#E5 G  juH,d}3s?/Gj%FΪAݑQNJ-Qp̮R i!:WiB\'(~ IDA+ϋ{0#IFW2VK gOj_}[o_XU3Jp޸<{73v s"WC9Ӄ6 N "KTIP3~Fb*^OeWGWӞ9@EPQ|x@γ;KnZʂ0dc,V.[駙xZZגk ``Zp"U*!Z=_6x Icrǧ+R|fw2Poߜ(6=ԩܥ'uKY(^.%M=f= EwLT>f ^͉zܻfj]oN{SW1>Þn2xnbwYH267gYgMmvW>͸!'[@+eRJ5msrƚ-s8VWHAL@! T 8H3 b(9Q ES2P51rbRѓz˪T k.X)] a~=) <ꎘEBR3HDHddP1 (vW z5$^/2V^ƮwԹbM4rDlP,Hav־]egůwqK\<'s8]˝rNO9Zn9ΌE$G:\7?o/+9tpL `I]PHVDsnr^tpE`ZA\RV)Vcf}Y$("fau VPMBaweUP)  B]{}Am`?]#fpzw>UCA3A3?˔O޻[p"y L,K#տEWWgZ"cBDŔ E^!lp91P?; 7+ߏE6/fذx(P {f-}DW*-r-)d\l>Ra%gP 8J~^ ȇՊ"jG7+) ðf;eL_eͿPXMvYu|tt>Ob$pJ BfҴOä?3ҕVҕ7Dr['a {ق[qg[x;dM.|'Y`dԑAL {|uëU r)|o҈AP4u3WG?{E#RV 23`17^/?]y2ĉF$mdoe/o s_uvG)G+'}ɲ9$P2>rqpR'(2]Q)©&땙Hn7dq7Y[/D{NV5M7?Q<[pSA_ye VIex m"޺M\؁JE6 tmlN,S|3y'yax b'E#I,赵-s6% KɷS\7`?M_?m &2X3bsJT׳8aX;jp]hARcW}9*Ǔ1$"J :y͎MJNQ#WXO7aIBd>^ S~.>Z@ԥkXKS^O"=\VGAugԿ8LZ?Z4=[(ŐID(P||X3 7GU%RH ut:oYd# Bͺj|[e .u۾>mF/xe[H|G5Ĉ]W?uۆG619Okf({[ g>.6]_$7,'>XvQZ)HP;,Jt)ߕ@"0p&T>y~=(Lw3J~v0 D0>q@``kP$Y$*#ǯl>_o~dX|tʡ(gAvp:tj<(x/paC+e!D4񯬄Ǘ*IB$98 .&j *4n u- 4k嵽M\~]\&]if&=[DW(k t8-ZԂ =#}z,ÒqZ#]}vm'9!B}hAfPRwR$X; M`%VV$ :Y BPS&nP&l;,_S>([6fDf{?âŻ?]Nu  aD 9Ԩ:+^1S<e78A;%0C3aTާ+@=R觽z: O│G<]X5mFgGe(wB9NoKjzeLݣ:ȏCwV 8TBqPXlPWg0!0{Bi$zW\/Eh=O)vep)F硵f[<:s#caA9zIv{EߤEGE-|0_ݘK!jz@AD)XJxwe(bDDte+1#%ҵo݅O˷L lګW龃Q&C(,'`}P4["Ps/IW{VFi2}kjLx,՝@T*"9_Ԯb۾3wń}n3"le|i4uXelS /Ǹ|ԑv]mҦ󺪋/ā=8Axm4 tVj(;߿зynQBM)!cvz~um2Hgm}w$ ˢ9)>|@ `9BqڤMJi~2 0[k,aF 3JHHH! T?f f\n˓,pE@87)S:1d$ƾx:@Y=]#"*cTTAo:! =-f⋐A  M@wT[CYDA(3ȗQvnLT]BӁѵVUB (iCUE8$>ʄ 6{Q>tI}YX_ /@2B s&\[dMyNz  g?s!0%F"bﶰ<(ʂϮFS20KI#23dkWC҈P*Gu5[{*M8x1 ~pYr$!22BCFt{y/u{q!Ǚԇ`h({>{_OxIB}SatGDb0z%f B϶S%vLI׼VsǚU{j"vt^BS*S\T0e:gdQy @[x}R,;¶-8 ION?jO^oc(w xg[w{;x E^G Noz/]ɋ*?+1t%uZö~:7* UIFP,!RK vm3N=Y\I~P2m2-M:,I^RE5{Kq@<$!>GZ]߫qssy?‡{^SQIvf\8eJ <ңOsj@0T*H C*(8hwl=ͳy嵜˗zDAp7!w҃%u z͊ ZN*WEݛ*ǜ/Y(dH{V#k8.Ũ {C+nďSAأ9wN/y=esbL+ANNlou0n!t749q*Inl-YBР=\$RŠ4d"Bqt٥gl2 22LE>ʮ/ޣ'EwQkC$ׄZբ:I <+smOԏV?MoW\,*D۰u_e =,Zԟ" ǛKKǵ͉sIz86֏U~x _vW"T\7JUniPag37V!mَl~zw]4>$$ $Eq80$da(}˪z=ZbT)NT K;G` x*"CU;#LŁ ?0\qn=${'OB\Ue_q?wk]2MHV e>o5%zfݺ"DXIs!-]hKs%^}B`hPz~K{7PG=rY 1)>ÔѮp"s >K~(|xn;5)?v8 vqϔeN;ky}c,l pJji޵@Ghpg:] ]Cld,T{Qu7;O{[Voe!c^GHAn7]K C,D22\ 򋌠wdzLt\+g($(N2^_B҄^Q2 a h5p8jim'彭ﯓQHB$P }qs#S{H^^vV푔/R|,>^\ӑh2Yдn>nR=-6t![hn2<5{RWoW&}=c4A kKɼ֌9h.=Q]RaZqjrf'i.U=׿6`~4]Svw<hY Sתۦum8R ZĤ(/'aY״١q01$`GOQӟsO/]'ʻ=fvKսN'S25jZEuke2% ;v  ]P=O{N$+!)tA Iӝ08uTER!p\TǍ+hJxC DJ{:f'3|_H$A"4ed Z͈ jބE6T8wqrbrQ3vꮭxIQ (BvyW?wG@;c.MآB0Ħ?sjaz8Xƞ񹫅zΏbD7~H?Js9NBA"Nm[T'A#9:Ҁ%QY [ýau\^<+!}H_d̽ڻ3 p K~HjuC#܇`P A(H =\ _ܬ!L[3D.DE$+VoVJ TŭIJ%)Ҩy0 q}55M8ܕUJ"ù(q8Mҽ->!vEwh Wz6B,HP =_gu;^+i#`3]dw Z|}a=:w|v ?8RVchڮMr=#5$ uPVhN^= FIJHnWuqda 1M}+=F$L?ZYDzg=޿7P_ JJAPNȿ?8v }0D2C}` Fx/T3/-9̳?DXGpXִiH6¾ xGu_q *8r!BC%6[`*:5-KA V?'˖!U̝cթ5sݖ̓%Zl=c1d}.'%E +ǦB#pn- ?RU@NG r}oSŰ3T "ۣHj doJkZˡu'_VɄ\ppY7wv{vƨB@ox?@aVTEOMyMX<8ؔ~W.Jg<]]>U޽z\1XRI R`xaǍ?zojs~?OLJV"*:Ge. @ Z'Yjhk=zSK@Ä%!a@ix~/MUd-+CHVTe*K,BVCr"Ig0y5%(** 4՝f?4wN=?34U5рt+v0C[C@?ywm6T*"PxW[Rk,#qq꬇ӭƤ! Thx<)ŝ"sgE W:!d&_ hv_NסMm.K0k4>LD7D!<+F]O 7Ũw$;IQ@@b%G{ne%qzפj,u\|[" GKF4 ضN^aK 5ȁPރk8(1)*lD2~k JżD)ˤ}9A+0Q b Ǿye>u 㫄EWSkP'%;oZd{/LJQrW+JTi=Y;KתqSca{" j)yoyxVo}Wt)sdZosQ㻇1Xɟu֍65,CŊ0F7YrcӆfUxuX>F ^/ +|36$0$ AvnϾIYfFL3#n9}Y׃ׂ7>*(@ ?7VFh0}j? oyX?vwێZ'~pM?c(.ma>*s(BR\ XfN`]qVΰHNŨl-wp]jsY ;=}j԰vyRIMӾ9'A>!3qB -L{G␙ @5JG.d)Yvs\!qJO R@]S CdE 'ey^~u , n[9c(̔j<-0lK1Rc3" fb]JSE|7uRN8gNkPyBqHgMv_ΎxYv3VKonD>2O8n 7~. 9MdXQa RGEM-I2E0(+s.=C NW6Iv($Iv9Ð ū_'~vrn)0>"ZSn?&f-vti$\8r)]S#ce=jTfb>'[ThLo_@UILOHE Up+AیXK @\C_/ϱo_Y-E-$*le1RSs^˿WEgdЦ.H2ˡv]lzl|bC.{M希!M)RjeXlZV*dHIkˋGO_^wwޖd e@zگRکUe%fiґX )h(n0 z %zVu4!4@ D$~'_LF'>:׹ƿ?qxyZ]wq|h/Q@D@*X ֔߅wT-)W^SsüdW1Kd7VHpmxI0V0%?#?<ܑrtX0 νV#sfO`a{׋v.S/._A*BAJЛmO-󽗝pz E.Rq._2'ZY K# e ݲ(cTФia} Zo+MY!4( "r ôA_x}\bf٢=%b  "D@x,w^?(&2<G6nH.I{NL ҇-ʱw %C)!9+($\/h)IĜ L׵-Aɥjj4A%" @"hY>[yVuv ""@M ~mdI4z{gř.:wa7#~~ĞeQ6~áZb Q ! $ ۋ1)]qpr\=~802^ ]-VdjSTcG=g`]Ģb dDg[H+cM]eڅb-c^IJ DD/V>fpd@ZDxQRc1ppkzzVz6)ˊy9(qQ0B;b1əzq.dڅChdr|u֫$a$FI_Ldi0>G,%.f%&Sa(c#DəaF\}?GFI LDGw|_gH &!\_H:L%əVL /7br(!2ּӷ]Nsky{.]Nݧ/<8S=G[ _aP0ATB3{QB؄ [ZƤRe6/sGQ6![O}-ʶE /旫mW+p89Lw_31vӅAzx%<,*QcYbKaY >׷a>hI]6CSBh99^rYR,3vC?w?c~_fD~E塟 j2A(qT3w>@E7riٕK J݉v'hEl#g͓ޫ!wAǵǻOج 1&oҽ돃OWLTJeAit5;w5cdj&:VJx5y_-cͧ52:^p3>`JI}0$FMg}~,|.,)K:֠*:T_ jo~A~V\#5;*r_KՇyj׵˫@j JLi+JNyQ(aMA =3[)z)8$&L4H-ZGgаZ.o?7xoS~)Q–f`suq(ٵa)DO}Zb@ Nt<#*`AwwN9k4}OWy$R̞oMPFCa_)crX~c*h=y$!MpzcEeꈤHU>.}O [9$i8^s_b'u;3m /W}ݟh_Xs_+gO /+w$3{>ϭ=W5w|E vT-"#_ibXQG^vϩ1\&fY$IW{PMaTH[2ݐcLҗG pTj)u%|}/ǻyZw h O-a¤@UnJ渌Au(ZObz _#S=pd񞟡Qޒ/Oæ҉OI]cbL&(g*d40"ɠ`$̉D>kۯ\~~WsNÖ2G]A>ƈ"!?zwla)W͎X댝aƀ20TPSZ dU԰# uպ-[x:w˚[7Xg˺Eǫw3JHd: M: ^X p!~3=R Rde|>9D$X"ܯۺsvG@+̷̴.U A\JNu=q2U^S,Jh?VN#X5} <=g!c ޻&t'>Fnhx?qKlZ]^ zpnClaeQx&?X@#Ձ^ \l|9H|eQ= P z[Q{8&x.nDR[ iҤ QI?MCfE|tB_Yk;bmkoo+Rh+{nZtgR˒Є;S:jifƩ(ݒO'8%ڑeS!%PqWZ'@ 삤]x׿*߁-"^k?yrRaH~O_-xwpDCn8^z=z܇S a.WԬaUpBƅ!%nI.;C>Ec5R Έp() #.y( !  !>Qü8<Vy_X@sHt>zGDg:MjLr ~n[MR~,՟ֵFQt &˜:Ɓ $D`R˜%+[ZĽ9c{Z>w˶ϒ (Z)ru%- sZPrRܤ44wA1sKϔi)7~{m'ݸ+ XVsà f[Ʒd_Ƭ}_̹'M79O߁B B vM?~96=^>yYcPZ}5h :E_F?U< 2ÍH=i̞xjK t{$;S#?WWfk]MyYU+ P(lk"Oh$5[<UMpHfuG&lE?ԮUDm,@  `ޭtR"D5Uxhl)-ӵ>Mɛ_z({hfe$d$HjzUBDh`  yyU+$q\ӝ 9EG'0H#oL /:M GIvMu֍z;}<MpֳC=ÔA^-eN <8"'#}!}7ξ'3$$mlw?/YdfWUǑ·|h3&g*thTAYaYr-ck0H\WCΊ bSNf HET ޏd*;ړoW?ſW|{o\St&~1 Qs@+P)FCTy?eK$'Ļ}rq~vv[%f6r/ nMw M_#:kSs'#%<wXS"{7eV1| o"@F( aSK港ɾڎbAT1  U!! W9XaRB <CgV_x=.) C*+4TǭYFJA\PTH} WA+ R= $[m w& X(ෲeJ)#/=SL mb}dzȧUj"%UPl(A' ~?ؘHG?RǤMζDr'ɯܰiyr<8a40y@@{><g8>K2DDVn(Hׂ4b6i!&ߝ< nGC/ѱ@PI1Z}tZT I(IOqzl7.dSC#$YKs߽wzkQawL(}A-9-¢$Nn&5U$@C9HHEOXn!E'4D eWk04yӗOOq9 n Nfc1U?껉M*U;sqP8`bP_ou1AjǛcaYLr6$<0[5@=;6xbxI|Àrz1 ˼=:WnvrPAT/te^'#kzqa;/<0v0oHwtޗ! #C i:"(Hoa@Fi/4ysUʰA:uۻZ|(DGE(6<|"KUhugs6Q- D9{Ȉz_! јr5\| Oj`wuι+g;>3tPWRI|-0\i7KS*q.TF"tybhOHM?fXsp?zkyJZu\HITZcYx:j3L*CF3p)鹡 txFĈNLGAZp6E:\=1J>.CA"}n_7-$ ϻ;Nq:l$0Q jvR)?f[ n5Dt]LP r_ÀLD+G ""B,duHxLi磷N4HGqB_Q ]B $sjLuME1 (" TtݞX|t>-hp%#ޔ-ѣa̿P}5IN(;5P!@H$RWX0&% 4ytᢂHCz{y<]eMx y;xF&H$LrNA ] ݦ?tZ"#X  &l(;[XrU #<>_ Ͱ~r?>P6]֮*A ({1GP%U/xA[ʍ|G-؉~<qd>N[$I?# km3f]zS|ϕ^UҊ8TQZ%?;' a/.[K)4@*eLɩ|=$=QOSL*yP^U\A>(oL\UfMXUЗ'Ý*3L\RQwiNJz \'$[MR fHC]xLڧU1N+tPimpYB&%m;ZŲqeXsJUUR)?lo."D:H~N4$GllHGZ{jj6dӻ)JjoFKU }xgSe\W!tn%󧪹nąB\!Bf2/ulsʦx(xxC<+=7ݏI|75|{2k^O?)܏"Dlu.qľ@ ͑8?àn%/| !GעT)!Yf7WAbx"�ż[T؂I" dNJ fM)Y$k!(H_ke|m׺pˬ]rS3Oe]S-k2@pD>wϧwy!?럻0>z؅2a&tEy ]{2c^ooz?UoEp2Pn qAP%X7 #rdpȢD$ʠn\bQ_w>4*R@p9u 6Wg;mv!J:/}5{iBRO~Rr !p[?M$COBa*nHP'bW3BF_¨Q C7OƽG!~^rY1x:$€ACI(qE !ؓz٢7ѢdkGORh~Z7a ;,ė3]毛L  Q(>ےÐ@9ZVXa3s}MʗWpB\#50tfoZRNΫw[Q.<>}!P'Igi_ҥBB09|G?Sg{/cw@`$!>5?-ߡH!Hg|Qʠrxw|:Aآ/G" љEȋG~G s笸jAoٸ Rv_cwDF] 1䐌P Ezݧbr|Λ M1_Y^Otv1jch#3ҡ: "ʬGiDH͎ӨYET^zTr®66vD_x,Qndt~e$OFnqcW\އ ] :% 8/ B,?kj>;Vmw Վ߰C"ѯjD̔ b L̊ܳ 9#bSıLwis>ԡoa~K}r2{Tj+j>濩?'4Pp AJ/otd>?W}^\L<ˊcL_/=aO?|z/S I$BAr!+[iߧgkcUwiO'3&2L*88P~lʔg3_gW+in@'[uo7ˍt^z}nxl5={O/?w 2) 20Z,(mQ2Łe&Lr4FXz?Gޣwo?(^r.df~_c$hV*!bH@7h?d΅Ө#Iar]`|L!&ܡ>2[_HmĠM SʛI MAG PV$ H?GLֹ/Df@ ~xD>)oRS9ۣxg0P.`V~j+ӴC;h"$į4څiBLa!R'$3|H|Jnk%ڹ)ڠ>@™E&3ÿ>~_R:+X8]iz+6"Fz#UU:to3F8@_:I|5z>ѪQ;<][.G' i{L/Yz U}!f¨ډc=^w; x(/*_$w&MGQ]~uHffcyIQ9*S]4:bvy"#~%ON{{v$g/7̹-d_RËZCo{=o>Ee{ J,& K^̌jܣ?yW^F`++ƋQ 7-át/IAptu[_MߨǞ?SsT@[Br^%9~O[@{V37=Mi[`?}u;n.gͩ^-R#7M %d"H4y8{E HEZÝ"mtGHتSvȇ?Ky=m>0{' tM22Ȉ+`e9n3F4!<+{3p2@T$%J ʵT!- P[/ c\yx]a+hԥP! ,Y32jDFnCۻ0×% Kui&^픴SMogśKƽ}IL'9t*}~?!*aVj_ ߖ1OE>^ab`8q<_&'XuF{jk5@;N߭ss”jE.A0VJk^/+̷u!I$D?eF., $sݭRI/w</Lk*a,8)LL̲Z1$WRu`6厕WeW~(E!"@ 7ݽޭB5b#7i_vvuyRPwN,B$SL鿯3_;clACX>}q"٭IJG4qxUo >'8|S7jBjw/&8pZBen  C@9D` 蹔9:ո娾 @!Yoph?ﲲ \ܛ$B2#(AWO'OX n~=22Bn2 A!! l 72:Yl>S]ֺFؙ:fP@߻uq.Oaw+37CU1)!_^?}% +=}~J6 HI]ng~ȿ|q|.g<\?%CVyj::D@ k:Q % JI=6479QP"=`XvA.DS̓)79`$tCm{.*@hՒMm5d4I Qw 74?LlsVH] zܕܿྡ}|V@L]+'7j-e:Η`"4!=L]IyJ>ozj>lByJDWU.SF8LZ l Qnn-A@g,et9̂={@´m5tmtcT.Kl qdL~H;Q=*߮88e)r ;kCV$͜clh& novݏ;b{oWs;>~=Id_//#f" BdI( Msq=7ͻ78ntD)u U4TfBqS/P,w/YX(U 2r5/BL+ fE` ngҨC?2i}]R(Р/A< awOqB0c7y F$Ͽur"ҍţi+>r!b80n /hz\2./頋q=ɑ+QSa^ I?oa#,f0z?3qC0e|s$߃Č5tNw"<&wBnl՛#8W'G0XŐs1.B+\`D4% (>ܿ(3NUcw^ !`FzB@@D̡w~T?=#2=-o }#߱m1^QΈגf( !D p($BP }O^K;,4LwQ#B.χ)/ e jvQQuEzU.?+_]$3|j0P6ESXC+WB8b<ĮO{Cty:|kCe6x?ӍI_PDbMz~6lj li=ʅU?8օbErQ-&93,51r.RI@ k_XOJ ;O " ΦXX$GMfr´Yh5|\Bþ994xY~ l|FT.? IwBȯ2FF5-t"kfZ(hQ$_@Ԏ:^qMwVBڇHZp75UN4e*# _B+74<Ņ͟;G4玸= \I3]U4(Zn2Ab&OQXp'[Oy?1BsZ=9][' owu:MI`fƇBfe-mTf#L{P @{40J'Eߢw#%#՞Cfm8ZRƌ |S'k.G5YGލ d,b~ ԇƂbE0U(#PT/TJ 't5@ݪ!GU,ᮯn=ٖIz^ ᒳ{3}X Yo2A&(PANWW4Q5I1(Wun_IkYKl>hjU HNTX//K/D,h"%G.)P9Y+XJVYǩE %9;m5wKD?3>5wD@#V\Y aB r~@BA.>ukR̫θzϠ@z;xD|9n yKגԪ+J9{WTn}RzkIuO~xDR|Cy}CQJ"'j#>MzP,ID$XDd8'4?uc7[-}}7OAS[Ȗw0B(/\~-xއj>z0޾SZtTnMzr95Q爛9 RegTr̤(՟ d -E0םFxVݡ)J 0\HPU&,/P&"APt ,Z*"6J^Qb2HP0*  "TD{tN3EȠތx̴v0ˆ Q'{.pi* R$90  x$@U7[dݢNN-9~샲qrB`'lEG9v!M7 تzMt=HeIŪ0EAxLOK.0"kSK1_#t+1Uw\\2/ps"Um)Bϊ@&e^Cs"`vWr}{| n}Qr5߿޴g'c0bC6A ѣcs簷Pc M/J6]V$9ܼլ$ օ8R_Pr3+  <F ڭFuҦ@K.hѴj/=~^QU2Ju~QV߷!g.+8~tC0Tu | Qe,[}NӁU nv W9C?u1z]Ŕ |(k'OG #ծU.Cdh I(NJ*2LqD~G,! E^/Ft={9ś! GδyݴZb@J!D&%3 ʤbl@6Ge,cB28B&LQ`F2q9b \(.H3m m8ZҀ"MZwYR6"'H{U{Erȅd9)x6<_YucQz9jup~u؇~+d-z-ͳ]Ս<.E12_A 4 ( G,S,[I<7%9D-B2gvUsTh3Ԉ+vDKyR~|zrY r;@ق_:vn'vL?S.N5]=WEΔ|wC٨3+@1w9 Lc@Ft}2Ґ.4Ծ'ahg4 {zGC4 'ZM&%~ (&*U]UIQ6E2. $r 0uP%b9"[g;xvM ZzYIahJ=REۊ;XQ~5ZR)VaˍDÑj JuԪ0pϳR!)в+Ɍ> 7aZ&0D.d%i$4c ADxo@L㸨iQAwYFTlY4x#Ae ħD~aNu4#EfNn1:LǝߩeŪ l1L[rT\llwܳhh0aR(3EJ/ۈ uQ{mC*8:݁AŅA01W-}TZ6ȥUD& Pؔ"\ ޅd9pKu٫)?dIڪfホXojVݶnV^SNPu9$AUa> U@i\+ʙjMӸ;_h4Y#ϻT9sp( mU8n%sOr.ADU+ᣀѬWچ:>/Ktw{*%)0DDHHU/cCy{-\Nu%3Z ~ EM<Sf{?'o>#uK-".=|ѹob \!@5lkXasW;L/ӷFWɉc1GO$;%jUdD&VN ⍡7XٰTN?u{ >|:t`dZ0LvoݽvC6_.bHa(8)Ό`ё(}z'"'[n}&"Q/ikCFx 7}tau֎̲Ei0Mo⢊DX"1aN4L;b?z5Ǿ~2+g0e{ Uk?ygx|[46qw3k Qj !#Q* WE"ϱ iH]W_I>Q\C/`y̶[>ɽ¸ ͲEzEz#Ÿ0y\v0uDrp#kڠ `Ax8m_[4_ÒeDzopeMK׬5{R 21* S-c7ź/<1G/9Iε@"@0:bavԡ ^(>|Ʀru hciwM4~(g|n7 ft>wՒX*qvi5h :3‡ڈfI &⊐L(0*9{o#8Bnry5D 9鑀>М ̞O&x-h/[zؒjt.C+AHWgoKD~ŵe>b5Ud4X~g\>,$j1;qW`nP%aHЊKv2綹c|mN r0 _y;R5DT&;w7I 7Ivhs_ŜX%{/uz>+>7+Nng.3:nJHsW=}4(4x,_WUeWC|}. B9<>V!b A~SM.s T%zf.""Ň8rvwU[ܓ >o:%#Z sdA!iMYiZEeT-KuAuO=mMfߗ N8*wW<16m 3 : !%@Q`o[Ua@zҠ̱3$&xJXhCA܎#CW8Mq;[jPNzl/,m/T[i$%ߒ!ó5kslSHAb'DNIqo{2=urY]KScMA@h ڳ0?(QmxPZnPp((ҪԣqO{)~]`)wb ?LJǟQ;!Tj d`yM.|뵞r,X͢"ͼc޼8][};-҂<9YUj+bCOա&&Mۛ?,|Ƥ8At;`+`%ɅʁlOB_cN& Kd TcoD9 `Wՠ1xl_5yvMdm2y}t k T'J$[CE ў# /ܗWrha%LoݰS04}+łUc uM o{KBLFrAd.Fz5Z~ 34{j}ihپq&鵭 )~443@xr#yP ԬHU^&}?hw,6SKu~J2l5bsPKUml3ސd2 _gH@=v|4Ekpᵰ8j(͊>֒/Xy.%7 W!l8A&HN3v4|Sl!kM2Y0Yog8)D Ώj{KաF<40}.>h&ӕliSϳH/(Jϻă1 aEb?( ,N>r$sa9R߈Ivl>Ot"e?ߞ 5љ6)  Vv1OG]iǴ ,}]6^MI=N>)kx9a{ݍ0Vw=za_胇@˔ǭ(y*Dfy}:hrKn)&0 <N80,o X~M0q'noksFFdݴ/+RY++)vu,Zzue|ZZHK.ש& tхi^( by4H"wM  4,=vX\rO<'ŭj~N1濁T>DӑwhiT8ݵ!{M1)opp9jTrtĶh>uCk6ҹQ#:KnL;}˨`fc}ZVhW4;^5Nga* ΅^0"0{r4I%|J6m>_-Ӎ#ޚCECi)5,-y,V ;֫D?IBN =K۶NSb?N,3蚆&21Z"0|9]uYψ/junz`-<@ K&.ITDUԌUʐT&C];&SɢX >`Uj@͡VJ!-Sy VGoAГfPWD OΌ䜽*1&@Dl&FoOɖtldހpΩU/;D!܋>]VIK1h0<mS?&O;iH.i;UoHP0<6z $rD5YE:AUHI7O~ՄSp3 IS)憿 1_}1~{%3?i̓n+x@vK@|$G4!25[_8aNQtCۤ 2J8%1?5Fcnpqp۸ԯc$e]4fc+6@;p3w{*g9_Di$ #3/*GIޟ窙98xNī0yya%Z~ K4LQr aW< h8f#P^*jI#L{A4!2xTt Z;RU19넞bMO8=7yC) CP yF.6:iyc3o:D"XEd8 , 7 3sS^& y5;0DnB#݋ѤpN)v %wծR#W#b  J.1hJ{Yf|C%  `eV9Q^ h}pYs v?c wJY Ϯ.s n>3(D1т[sʥIFFzVhp S${^ RYK 0z\@jK'Ƀ#m`<]eIJI777yxۑ,Ru1bU$rR;~$a571l&:$a7ʩm]aH/~EжnXYOǖT釈Z'^"䋨<-19Qb]!X4{̄Sb2߀7EוNQ_;,@eߙ$L#XQ\cWex?OpY9}ylKT[tPg͏b nj;=ntAi Cكx'ށV1-&8WDZ+i:  ;rOŵ~>H{ä=?(FgqcUe*(F\ZXAޜkmBdjB1޲GWܿS4)xW]=M&E֘l$VqẋG(FEfQD>v2Pq>GV?i=&Fk5d&"< f$_Bcvt\o0+>|'8;,SGW`ט`k*#Rǂiz@Pq.L-XO7"ӎ_AAq~@hXe}՜egp?2؆tQidDw;@DQ~ݿ2Cf2ʢiR&#vFU˥/z /&O5lY:^\Vii3+,,7BΞ\77+Ϡ~1.bUx w& xlDWdK9btUD~QFow4L^8 IKJZ LXHDp-E6f[^Y CB[rϕT9p]d[ś䏧J4^FXHre ׺Ӏ&xy+c4zcdI4M"R99gdY2?&ʠ{GՅ_ξH񋒰9 K<B 1ѱOtS|!' s~{B웬&@B@둈c~Y)׺nd!>kFh8sJ4M:hLˎ]JuJuHݔDk }`~+/Ƹpr +?Il mvƤ.tRLDI9W"p>A$_'nwrF -/x];kJ{-ɷ,١Msأ׍VwU:2]J!Z is$L;: 5hLM4Nʕѝmؠh~amh!bkmy5@۠P ~}1 Hw4@fMVL|pGݱS­n#<wAE:9{dB jeseiUh']0h{f7MsC}u"ToG2M^#:ٶ_wNkiU7?9r[ շbA7D2VTˎko/ %G0S6cj^I!u -ӌM%{4k{*-ܩX63V(J}_k!]9l!7gOmgaX{VcJ:Gf ?)|M?__9'44u0J+;fSk&^0kN B&u(W@XE<VRtؘ4Js/^_gOP S_ MDLJr}ӨTBG= t'*N-ş[gp]tA A#tsn&eDx/̆LDm4^/e~ 7glڞo{^_iܟO8/\l|9Ze w=қ~AƠV-;oZ!VO^UO(DOw`qΨ~B+gQo/C姼/p5{p<bP 5U^hRlfR3KRĨpil 2)pWy0KNĎ5Œ -rى[ ԫg f)4=&05nT*[wcBkbLȨbyhnM,!V j!)2[\ 7юЙ2!5Cm :ůOU&.,\dγ3mzNA'RmYݛ# &|R"bKj=ӜCzh99#iKSOܹXp.NԨ!)I%LZY@ (Z06ߵ ۤh։Ɣwm%H8%xqBJ)a귎Tz/.c=E:.[v,Ww@m1cd(>:_1Iu<3ջ!\6¼=Cg\aN X[Jܻʓ.pM"d(-?cFŌm RLO &4swzx7ۇDޢ:i2y23_'>ƣ= 8wL6.7+_&ĐJH8b:k^tz6v\'a5^}W)[P{u-/TV'q'w}w' nG$>)PdK[$/)(ߪr>k! q?Fe(ܩ^#p_\\&%$(P7j|i9W}fDq(~1~6㎎=&ʻJ|1]ԫ`U:!*u+4okaH$Y/xhulZMsq#i36WQXNmnZB8]lڹHz\)^n 4;oi*xxhq ^;gsKt`\[y.|m?RR f&3r_P #굅MRd^8j7rV&:!~7Zs-S/8K]WC"ܯp=;_"W3暏8z\9+Q7~fUWHC]>g8fވM5jQCUYb ܚހe:&s d#@I`ج E+~_ esTQB77>5-F%'<)&\@Hh^-qǭFQBbr(Q{ťF#^͟me GٙұD{*wPo/h Q#2%sֹ"T$H}\ ꝙ{+0܁25 H5(,xZ xͻulnv3p8shf[1]!% κdg$ I!PD^25ȥRo\:$(yuҭqa x3b)cR{F-W%9t7>s Jj؎0i&9IS{sdy^ScTEX01yB/'MXl/Ьe>˕Lc"a ;-/ Hvr\FB% @ IJkC{6>ja 0c12[(k 99K(dY$[MmŬSd\GVچ q̹nZ/pyk&,Ћ nyq36*_ E􁣈M$|5CI52&a.YֿsrOvDLbWXBDma8/* ?R,W_]RϧP<& |qxSJ}r 0'>'%}04 Œ2CyͦgsH]C!W<Wۃ^ 'Cl,>ћ۟l~IZ.!uN+0.8Mݦ5+|jWtڂ: ^3}y0U%⒐BY]Ц}\؂J 6DΕ.0<%u˃d5ohC*GAƁ &ߗwlˏ'[mE"L ؔ`>k'^'tҷک?#i)k8OQ 6!(f@{نف2R)9:0v #. 6L{ԏD1ҦI#zDbe@ʴ$ RmGx/`zgH% ~BYقDY]B>!dL8Jĥ6/0lוֹ.=n ~?&{>ar٣ u/tGҎOV͘l|w.635)@o&G~Q ޕ$E ^21q$@T6ʄPVݺ9-JC})h %9/YFc~Kgm.K蹈iӬ>HV f?5g{}P\8Ng>dOSC(q* Tns*N?u7,mHa~'ptӯV!ST2N`}H?{S'|y6È+PtVqk"dT  ƴˤ5wG]\:`P4o- &jrD0̓P+o7vm%O*BȐ>}`{FP$$9km0&W9Lg`JaYӓPx;bbR9g0>旈ع:dNbf]?pH,[!PĬщBO8i\NN`YܞU蟗._{v-x pj?hMb RUpwua:Ժ߸y…>6G>=IzW̽~:ls;BY`!%JiqPjW^q>AiE# 4ɤ]ڤ4YdгAg#h]UZȊ!y G d_:FVdרy4M%k)I!mec(4adG&ïfaJȦ^ (%Z^A.xH}#! "BK0>IO:7hXcQ=%<ݚں[pshޣS**_F\sSS}zrfդ6 W1\5Hiè*IfN՚)ySs'ޚ:px]ZZ2% Y Έ뇊H /CCl,|dQV]Ãɨ`)W^ѰLycMΘGiގ~+%5-+r@ÝTzMhHtmǞgo7- %Lq3,3}'KVjY}=.m$͊ ObddTwv׆Λp'0A40vb~G3ƩՐǗkb:1g\ 27i.mk_i!_*%%kmB<㉴Otwg-ow -(bZ>+Tg6p{[shQ}7Vױ`QF|I@Rj 5M.SIIc"!}=2*ab͚.Fd4bGd+%Jycf>9%þG KQRUzs7YgpPs0k7tA(~5OהL7f)l#ٯMu@oeI/9҃k.F'Ȩ8H ?6n0h +4 0IJu P;#Lu!xaSW$?PouZ 񴟥qz5i3ye`NS>|<_[gAo6k=-yuЇL;픙R]BݻmtFjlP]+?k nwߺ_ߵY&Y!e-8pdyڐZI5X`==$!xjvbR ֟Tۅ [gj\g$Q6{ܼ 3іްbN%;"ֲ ?`ˁ|&89wuKwH&lEȭ\:X(} /o7EwMu=WMq.p5@e6t% MDi^bPK/(N}- ]9 m2R-t ϋ 5h*Uެd r$?E2`l4 ͷ74fvrd%%2s|Ե:8WLġi ~a3WŗQ-\pC7n\G =gɞ[Ol2@kDhՆY,}g}!snT*{_2@ o @*L &ۻx#:Sj5NS'2Gd尞Y9AKG[vz0$%X_t_5!Z@j}~!"ѭ9Q}[OL7]wYX^ݛ bg,Um}A8C-9ڸICS% r0MK&Gp?㰏}Z@%䁛tȺ褡پnwAp{a%;bctetiD_}v oW*`a1;L+[k @ySu9eF\m:dءޥVKDDFf9}XrhCc5PZ]*෦V6D/!*©W+旐 STb%へ^;6ୀU!hW.{0zK.& z[r_Vwc =Ռ) r[9vjl*J] uCt_hn:G2hkٔDAhEOdd:PQQKu93mgܠqp.$ܐ5s÷I%Ny9Wq=Bւ45Yk!V8)7KV'Eo]elr1)&|tdct;{0en]c3c"dKy;)4#4=.w&`Hl<+u$ f{z"8= ~h>Pvy-ii@q>-woі8ᆙԐBq}X^e$PM>y3ͯ$=6 U )TKѬЌ*lQez{ ʢ\D8Éxeo`wQ>ju+{ qX+1cdZݞH+x-c, auVu)\Zf~΄/|maMc <.חN jEPwkQlQPB\ccѡ1byRJ?;ց[("nN\`]CYv_ kzL e+rI^К3$ja- % >VY`R@ z}٣oc9Ԧ״hMhPjCP5H#qv'$x.C$2|4"Zm-U2rL/<.%!5-ݲC#V)w{Ù5jd!!l ͭ7@Z ?GNfE3_ΑqT4W&z!_Is w2 F&̜,#Fy;\Zdۃ&qP%3և5{j^li~PNU1n`4+gc#E8"w웣- Fb̕tE_rԹH7uUWfx'2\,c푣J>y;ћ'>iFfTp*׮x|ge vQt?:_`T"hr@24BrjۅŸIRDZP^XJݾMz%W~ӭ(Bwnx8 X6B`K׈&e \KY)k~B@$L+HG,9 .<,1jXp7op()6fݩњ61 *J ۝/J[F;&{]>Iǿyc n77-bЮmr5[Aˊ d_XvTI'_WaDn"6gں2hm@r<60S!˩eɤy3RG]_:f$nqF5szFm>xmvׇwAl զǏKjկb87H˂CmNk̿j`ea$rTc&sN&Yıd&P}v͋2*d!Ϭ=[- )".$XD3~ K$\ʋ3d=>cn[d}:;Y`Da]5qw9 k-^"kWNsy8@[,b2ӱZ=3>mujEMR X$txXHhM^HK Cnx̯eWzc_%nxPP!Ƞ" uF#qZd"HZ[sC"ԧ08/tk9^ʮ܋.]iI, SC_J8gɟ,q rEq 38RDi][Y^`9Ʋ)~QrGY$[KiQ;cʧ^c Mh[XTWy𹽴cfPL4|bur K:Ԇg1ܫ1{;̝n")]^t$MaX-<*dSA Wy"84NBMc{#G_bD^Q4?[L/oJoĬb4ȵPxw^}[l㓙? vl(bk߯ q/Jgjbb#6c3N G gT%1IBǁ&dA?q MW}$5S ß,%Z/sK- }|WgSJ1 {d_n:K<[jG,H&@yI^&)_&D^S xii K-PzvjZ3DрgdKΜ~:p/b ox){b^Q_pd%KN!c.,["&xf1 ЈAϗqlsrXT#;BV.=sAN{XqVbWsbjzzXwh=%7^~c,#Nk 7y! -Yꆠ4HFr_Fr}hkv? ,)9g2K|UL4N qE̢.z0z$, Ld fi:n(@|N) ]0,D|RS[c+2$)~:>g'f ma5IUўoUjldSh fw>k$2d!c-sĀuG=MgȍOot6ˁz*g. OC*Fma-\hp^pT f?ud$Kbq){CtZd5-aP 49y0Ff4]81Պrhǀ*HG_Fd~_=eG V H |<ʈm&@, iA{g&#?&h.Iެ!+Vӑ?-RIr=/{AXbk7;m·vW=‡3SS%-f2{jt`z̀˸!ɄB4~xjfv3g.2U(L%_+ɗn1WMH zf(3$ Yndk D pE*p{u|C>3?9{wC9zd(פ$:\w &x*zJG?WGP'N6+3 ܄Cs-K{K'wyBh/mEO'nvUس1m9Sp(|"1˾`GUoUʈ Nogd8@VCb) ] \v`>18fpEת~hJGn`:ҸH7/Ub{f0ϛ(#ƴ=D>D/kIy<jIWOwJ5C 8{0o932cHzGe|ڮ!}j V}Q0S<|\g}!}<`b)ti6f{U{®G =%!CS:X6\h P[x1$VpTp) O\}k4~jҡ@֌fCRh.![bGΦ At^NKtf ]1px-m+:Q ).^)2eH*dGc~|\d6cAnT{1X' [grBjvv;ad=e:[J_{g (uY ^U}fś ^6fPVz_s<N ^:e9Զ;2F\ )jLldo)T-zn{aVA`u4WPer ړ̷?J`y~{#LG0.-{0UUmGWE,Ga~$3SFGSS޺րH+MFX4%|`9%S~W+HFk1lIith`JH6&u0UIY$"0%wa~C'1&%( H4<3T$D<"NdGJjX )ZVaE͛VAطL\+J5sG#R6`-&gvrgRp׿{wWQv)ĕ )܌KvSX,#X1?m+LgXd[ËWm~3sVG`s/Q aLη˘?~Lا "NŖ\⧁.]}^un9W#D7sDl%$SHk| 3H`m'mxOwVtEXz.!6wDLĔZQrJ6r$m`}=KG̍i H"y-UzB=>PAEbMu)@8 ҉ggP*:yYKJAENuOa ys[ *(8& OKiKgF/O&fAj0CɂBя{H{e!Rk^^b'&Un4ǻv8[@YRl{JI#1 sͿFfF#ɮtIZ[ m"'qoĘ~=)KWY,ER/W~QX7kvlFQ˂e1H(44z_Ar||>!ɼ&Z]/;oV1![Hy;r(A$5t]Л+m5qmQNt k&vFH,"7-'˺jAʾ*vFAS\94.Pye+m5Vi&X<"ۆ˅@ XZRd9GL!O@.\%=`SM8"k< [lXö\`Ẇ7TT|! ֣Gju^gZkg.B- a 2G%j8IS]|2stM)A@eOe6"!NȚ( RE:tMq_yeJ۩Eis\cR@ (tǹ:ɣt+xcvFň(%qY |WЋ*_zqJ#  XPh{YסI`jsw}3PgYz܈uO{GB[5'!ziХ%9p؛}>-@4Әi5/OĬni#@xFLTSlE.n"#3jiNJ!2"䰰v _siTi"''_T?Ξ=WzsHB#U+C?PqTrzGcI{6Y &0+^7ć U4g7yN **Q,COlk+@3cͫY={zMk 5}~/-+$fOā观 ^^Bqm)$ :7֡Tj206oxέor֧+`)/n8@XW\  W3P!S.  bEw!yp-tѽy+~Ok @dZ;Tm/!k$2D|!9yKZ>=zi`^F|y}-W|kb m="g˲^(Qb4{ &Dt0ݘ<1dP:+|~/i>dư('V1g8ltBEnjM'3 [0uHF a :Nk^й -#K%)e3Ǒ]y qf4oTE1P?aAXG yn؁̱Pg< 'SaI0Y5,ce<~\xu;>JT@RN<UŲ,mRѬQS&ɽVSEWlݥ$!l ߬c/n;ӢI3/%AѼukϔkA:熽 z)p)(ppjO K&tQ/ g N(-Cb7nnIZ6}'JUr@Q#8p{J1ĬK'NWcLP}F6 Oh9>Wt> ASP\=*mv?5q FLuz+`:lO^mPj7!OFvYAXr!\;ֈ'J(p)i! akr+xԞ30M?G5!B ~eem)>gY&CgX~̶S []}U1Ksm_,v%v;&H~ZiS2⍊RPn,N+ݐ:O*NȮz9a ~xg!*}]R()کil_.U-cnb6W4!/xRߺ?sA68px%ٯgd)A:Y<.3hب=d|'^uG#ޟ iz] ʾWdFd\ /x g?'b/}.4NJ6P5Zv82P:頻'Fs"8+W~xJ SSNۼ%s}1bi|6}1&Zab_\o\Gg.{ޝP\‚ƕqlR ~@F%޴]K3LTgɭ[K`M}޺?3Ym55D*Q(:\NHcRVb})ߜ=A#^,O΢p`gR+gL.NNq4XFp ȡMb3sW6r_,j:+(1 oh$aLc$ !#&׃HJ]$ 16w*!>w̜-'qa{8q9k[Mhf}eSGʠ ou-maE[@RjORu4BV`0+ p_8ʰ}SLrx|46#O);2milv8ۇDciXs|=jn`ރI=Pl_r?7MJ=G_?J^vpXiЩAꤍQVTY] ;6|5[Zm:-3^e*5NfK=I#;u1m;ōV rآw ׇV[}q]uqGO15EK&)@h "٨D ÿsA:RGdIQOaY; >T۰I m#, TG& _ًZqEgm`JV4:'Z׈yϬ?pW0$yuk΂ L;>;QB".PM0J+utg^Q Je%ךkI}~rJZL%/Ѡy¶IHFR\ Ô9؆JSR;pFx2Te-3C`E9V*ɿu x9vm<9]8|wWRb7{mHK:9uLqQl?AXH+@r{2 %$yO!5Vڋe9t'^o co(n5ocn_֏Z1Ѭ}o] Ҽα9t{ߌ~ϩgљ ya~g%4⾣*TUkI6KU{Yԍc_"v\;!*ͫs_f *fWGSONtGdO]G9 f3UҝTv&wlZvH"P N "%iՇ%&8(QУW=jSͣcl"EuEāfDnSvM, ;mv`34I{{0"S3CcfQM.At 8,˸~4qWi k|I/5 s77uãw^X0N>1Q]C%>Jmʈu$A-ۗ0XֻVAwO_3UNNqbMI5~;n(qjZ7cjҸ2Qe.k:!?=4"q+ѨηڃDcdPq#IϪq17L^ E<:H$f%39|9vj-Y:e="{ q_s4S QcU}́g0)Xe@7r+ =l-,ߧՙ[e6~MLrUP*>v(IfZ̘7?Rhc28Ջ\*rz ꆿE͘[k78xK~g[㳴T\~0k^֚CcM 6Nia/b9"y[0U`_/9A/}@2v{nޣ5A/#pcIYX%P ʊt4¯B0/¼Ԟ1d-CjE\?jȓ&M;}b&5t)? ޠњ(%FQYݵ0h%Y>uq{Po'skqK`#¦¾hGItT nA^waZrl<*c+ۭ10 l!(:y{/`mKLBqqt˕kҲTEwn+.3\xNu-e>'X40B#[[*GNУמߵW:ꒈRI9!LSLL-aIB%?аd qW^fس0g]!5ᬑ\T~G vL_7*-A:Fv D\nK' w(#x:Uk; y5 YNmV9AvkF7=7/Wg|OI CSMؑ@D! 3 Xq<),ÅrVd(ۑY @x=䡧?];ؖT ˎ2Ÿfpү˃Ƞ/)ߕ @D䟦U'I%=m_rXJܸؒg?qa]]T ^tm>!v;wUINSy5K`ac=ƨ!hz ʈ7; EjGg)' =Q. Q nh6*o hMa} Ay O >Saqcv/T@J<5 W稕6AYdl E4 >mcQm V)pO_MO˳_")B9::#Q-=&zSސg_YL+#m S=Sgm% \GPrBgEbMI΃`Y_ҵ2\ռtCT8~k}9f F~U5Zp2˛I&[H'Ty88p\dl's)0 8 4\ׁ"#0Sʛ gYE,&sjE淾:v(s2X 'JGwvSrPx%d!sdf/8;`r7mKnv{6c0mK 2i[$o|&;yJqZ]\>% 0 c,4iUYw5/o%..d2ͤaVq8dt{cbL𰔬nD@n"]=wy{_ 5AJ79^Mp Ԫ,}@I=LbUuboQOOhTHd[XQ@k!w{kc2(n񡱦T-֦MtY/=KL48\ jiwT$2 g{uHjhG}J}LȌpFuTz+v:ga$鯍  S]3GUH{6(3oYh<򠳓X>p%9p~A!83@֕07doV\?RvR-RuLDr#)]#Z?  3`{G>5%q& .I1}8-&gžNtgpB*3/!zRtd6fVZ,x|-x G튦9L7_W+ mdAiJuK ΁o㺜|qd /.HHƜ(! GH+0л nݕx/Y|vKa<oT*:AEL*qLC&k=( 9T]&B W1?Կ+,:| .CKx{/ŗ@j~~yEhQUCS{t#te@iл$hBjEno_Z@{A7vrbS^?؃Ǝӈlu *Mt\MS&S'N`h7taI?O唑W,+ٞVejl_v<|]OUV" f5rQ 3H.`q/oh>(@Dnyut[Wyc &njNjtiFg R™%Z @;"3o<2u;yHdgH5~\a*(hqv{1ZԄ кT\@_u^A~gZH@z87^3"zĎGUpdbuT(J VAԀK"E̅c(\B mp7ewRdtiJ_JǺ>KxçA &≪錤 ~Rr gk$L3Ĉ&:=) e&BWP%dwel2F-4~*ţPO6wU]oYԊ4;B/G9i緅FU_ 60upŌ= ݼ?595*oAwojEhd^QAE ZJ?ž91K %ۤ)ml&_2ފ7kOe0lK||"YQMz!N̋X y vYee|>fJ-8ra ɒ4BRztk\v`gX W\zuj}= 3!N(o,v{GԜx~yϋOT4ިJMhn,&z ha$AL)bKD2Ԗ6Hwn&csX'yU^N~s1]ڙ !Zaއ14Qf- Owt Uɲw7N| &|geSDŐ7B`FNk, +ϗ2rD}D}{lQ=`DP zI`5{>qeŭoYrq,;ZG_$rP$bXLG5<ʋ NW;ix|אb%%V&PƝkG {^zȻ$Tc&UG3nZ ˧x &,M/Hr?TʙmBIĤ[v8Lu;,@2M_2U ?{0EfHc\i~pڎ!)˥LD ٵ36K:7i#P73U󞩞M)sx6&D}ZJ@셙#jǙ,GfzϘ >>n; Nq`P(d5 9rC7=/K/K 7/W Q[j: ;#]!~O&TE.e9%|r4=UT S`SghX>8u=?r7\4/;DhHʞ{ !e6a9o8 VteyM țDLln8iog_>|ҵ6O M3mr"2m{!Qi[+~xV9R;TrH_p0oNjUkT ݽN).DD[@2oL7 ew\t@lv~ V dEq?rmG lGN^H (r'ZAN 9|Duvs"QU`.s\RH$, vB,{/ƽ"̒mywnh);7:1nmI %}t-B xX ++Ls:` b6Z@Sk&6jԩBHs7ycjx+g)gQDK+тMhvɥU$4&*Iy#f+ٍ̰aާuL 3vnNcG/9"xY Mf.W0Ȯߧ*] "_ʥ}dԫyWZR2?B5qeDX]yL/Ss>p#\\f[-ִ䬽Au 6" ūj5:lQ]r2N_If_q\fp>գ=;pU;qd0K|MDշF$i.g^(gtQ' 'v'AI-;b ?-)$q:G-ȧ0ͩ^bVk_49Ȕ٠+X؂՞oQK\/1L-k ^R_\zj^Nv|y*)~, 1*xOoA1cΕo׆c`jAgdQ-P:(C9&Uw\=' oԩ?k_"dh*6t%9P١qP0xgؽ UhRrB^ {@[;]gSd]mMݾ13yDCDXTW~Hbހ&kJzwDr1PGiK=%4/aJZU7InQ߯fF2}T-sTXkƗL48埊!l$LKl}p.n?un.+;o~+u+盚΃с_p7lm*h4Hy7W{X(찎4HUqP};e }%.zQSw'<{4 irJ3%B)cL(>8eT0}݊E?I}uy܋n^ʽg,Ӹ*@#yOI; -w:EXϰODN4+{0d5ZjD,][1BE1Tt\nZm势'wR*Y0ꗪGxQ)QQ*2q ]v4Ʌ/Rav$3Z2Wzجd+{v(pZmB6$$p C].3ue Y{Dph.$4+m ׾Mv2+9%BOĂԺi@3bsz%}"ﯲ "20@m1{7ިtnJ$w|~飪7L.UƗdHB/YP9!+Vsb%pHD @95W9w;L9F ˉ(d<d^J0{TU\w{F^Sƶ7g6^s|5ms3='D&Xzc{}ei\[b*SF~Z]Vɋ^3+ψw\L U㱄rYv[KgmF$Rqk pUFl-Oh2%+WijY M1pt]Q cEOE$l>\]w@3 D9䥜*ڮÜOK*Eszdf09;nQGbe)kY{$c 'dC_ۅ %bb]Z%pϷe5v8 D2<DuY1[1|c Ut:0;q]cN<.b%pwͿ`Y5@C8ɢY *vwlj"GǷH!O9TWď՗!iʃ'Sm߈ @U8].\*t!Q,^Bt»+zYjQh`^iw}r9>²M4d%0.O͸l)ubҹ.}Lɴw\:ǣ$ӣÝ2ȆG #1^L]bh'ģlo f¯@tOJ<#Di L< T6Bt,4_g*{;WT\CB5{y0o֣<)L0sl'+Y|fyhfS[ ZcZ03SϸhЁi\^6HƵZ)7oH;D`^4U.VIoU U}_؜>n9l3p-'I<@8 "-Duq(R] ħ-̮T5mq޷d+^x8xOdt:p>J^ WߝR1H+2TRjУNJjEm4qN-7/i-af!Ym $P)U/jVs.x,``x4 AAG$=|K#d$4{ݢpR^a'!bq9O'& ^w?jQX*%vi(AC`g DE*4^*=)!xI98slw!W /Od3 Zs :P˃&^O* M@(]qJ%R,CUYW]CbɠJD 6^v,qD|Vg~u-W[Ϋ(cS0 JՒ4 ]ׂsD09f䩰-EL~C瑲C`[N^mDNwhgZ4QBL z_0;&uɡA.G~n[et]tgѾ~J FldmPu6qRRTm-T24=3ooPV^dE`~(ۜ(vg˃l!sD/\JIշNszsJv-yYxOF` 4H&h.6#S>!Ls7ĩoof_/clDo{'@U$,5Y2a-ʤM[ޑֳCSgfFޙj,yMԓTو]D=8k` )(<4 h%KH8r],ΦԜ6_<9dfDo[t w!`M)=6"Mza]{С  p-Q!SpK:&<]~0A 5D "+uV5bPo?c\ꇭ\]yYr2^zEAhuхzLt,2Џ~*2-eޚ{?|a^_ٰ2ߒfۤ6EPeecj~<5# }MwAP n|+smTܨؚwMjd;5I?h"AT Jh=dbpM>T~;ދ`1 b2eٚ<"LdE?܊~̆joy ڞ 18sv 4Q4!g .n97g{o_e%@-:Զ'ѳR$$MQGylrS89ұ&[挺+-&Tp۱ "njRZwez2Q[fNߧdk*$0-)鈙*ܔphU5h̆V tnh k-b X/$Iqp=2(퐕<+zӳsDr9rRøh[bºwNE!ܻD$En͉#4[iXBPQ} fr xţR^44H]p@R3qP; l$3R,Ap=ox=x9E0) $irhHj)"&j$ʳϐ.~ōp*8gҰH$:֠ecx HC9xt.Io#amZ *z$_EI1[ RK{-3l S5Cxsaf Aټ>~#^6 .w.+ 9'4?Ղ}T[L?7GB#Uj1-ūjugWHP5QG-yƜ=xtcŢ˱&hR\v RslO !y>+IiRgQ#b8sdID|lļy<+$~7d2%ƶ0@7Hm!љtpLFYǐ}as[JFj78=/nS0Y9҃KyDB$\I!F4]KVN16 Qai` -@ζw:u.1jCtF&0?X_08/,//ƁA_*Qu6Pgl;pqI({@{mfPcWlN٣~<Ϻ xbaGR]D-:CdD;f&geL=۵,Q6{W`֣}#Gw꒙hfK .qgo ︿ ^W?tWń,{B3[LeGRl4ip1k{X% Ӌwa&.!#ly$Օe_`eUEL6[*:'ꧩEFu'q" nAb#OuS]d v%vOYx^ǭɤ˽lkV P]րw^ѐع 8 `g`wU'!n Yx&F꣢5ݟ?UO2pKh㔍Cwf OUgZB\n9F~ثY7+,bwP04۞KF HloQy]¯#T}='T/~3/o%.+Qlf(Jgt'Wm)HgD!Wێ 2.$m<ʛ|XsG{;Yj=hW)/xN748OgQS.#ԆE18j¿K'/7?Lf^aܶc蕾F-`>%Ou r]EŹK[hd@P%k>߳w@RBCG}stMo %V0)㬗ӝM=bXg"E>d$N4'pHᵕ@x?zG+&n(wW0 NթlwsaفLK^~Om{S2ke74<;0ohOc  h;bu&'5kiPX1zJڷҾc3A |?. $vJ?]/[XP#ۀý^}S {hO͊#GX; (ز6t@+yFeS- <AbBh9#,u' m,.*(jhY[\1BuɸJSU{Jݡï4;(o*M7r( 6{me-E,;ãdAc OeiIlo!Y*jgdP;/x*c'J *`=4p4!`7},$U,~YV*XC r9iȄ޺E.s]ƀ׀y//LgpRQz#ޏYIBs:˘=H &ηkԝd1јNx4/iim"o໳7A7+LԄ^Α;zBUޠq]vDRWvT,fi3_q0$CUe ANȾ\7qn|YR<6bczJipjw)6WPMM4VFͤVEqӰh"N|\*黎NwjP0QcV0]_xݮwiQ1R|͋o/x oJ5Ce!-R}a{[jN`:VL7Xb )-@Q_%R(.xNN[)YR\K|7 bjY{ a.\ 閭Uq Dd~|$6`G( 6X]c[dc#u]cy`Y|khMca$d f,W}Sm\cḪ8i4%3B,L'vt΂{OyE cZ`F(U_@7Ogzs}ef, [3" :^b#:R3bSWg1d)rM|>5;"@Y51QAq+$jc+Oͅ)vr(Pk/LY5_XfrLfqq{a 8(Peو UmQ_z 3Ld޷ϱDr;Mj86t n9ܷ-tFuyだKr 10RH`R\ot ߒo(B, 2<˖p¨Z=MeCJH"%蛯;N"(%ŸwWp7!C[WVaxnF ~QlUs#ϞՓ5'a)3k OEq2;QE2c=XZw#~9v\Fl},?h~g!%ui' Uec!>6΄//*՗$%StT g孌%oqSx? ˆ-PPEfYm+5&䓆x''Zպ,rgIOt։Ԃр=yi#G%p턨:Tَ-ɿh/.YQ4 %,FQ XJ4IxMHЫ,[hMIZ^p5ٯ:v@RtN[,ᘱ M @I[ ̘(A[mxu U;]=MٜFjV-L8;1K Uj< ؎H#e" eKƻaU37CNUԺ'>ў_W#%S3ǀ2Bo}񢱶bq'-ozr4V*$dw> ӯp @}7\i3{H RO4eAyqG8WC\Vf8.H:/҃OE b*`_.F#]()Y ΣSE]jbNbD!=30 "lU2+&ufa93fZiH7" ejj Ibɜ$չӮ2mcYkj49֗ґ!nph էr[bY7#LYl4q36(8L<\/w y~}~Ǔ}>Pcli"p `) Vضє[ELo3B|@{G=+]eoz0 qE3bsW;I3MB$_Qs{D,R5d+^Y7^(jdʞ$$@U[}쀽PC# dsZ U 'x$[g}f KcUX.¬h.}1R&(]ۡoJJ8K+bg/#߂>{mM E'Λ&n ix[Yü60{DhбkSyS 7u;ySާނ1n<Q { T&&|p'NPG *Kd؝A뵬=Xȉ:0IC <[O J"ͭנZ}H cZ_. :f{ y;pl/_LwG*0C/)1 7#>$s3i"/vi[vD͠~| x>Ϙ=[/#kд~NOAyMHOWq!>I:fёgloVw6VvS7LڅU󰯯j>Hˇ]fܔGHƜ:='hW3?]|3 qLq4 ,XrCl*݃<Жa)(G8x.C+YХ :4tJ|Z<؞eB{7xIuRbB4>xd'i"r*J\4ꩄZNHCHtqG8AJsh:u*Y*лLp+jy5djHSH*x|5g"< $GBt$t1-Odu=o Yg,olCaNge鍘2~z y: 󔍬'~E1sP+b գg8?ɓ߰ vEbOۏW˙MB=L#uqrqK"tj J=u+hQЖb( uqkҿ ?Þ<(K}̃D1F5 cd4 *Oǡ0[8҈V(ۼ*ZS(]ߣ*jU h`g!t"H#A2)o-jݷE mk/|$ (WKX2^< 0i9m(&9r(F?5{*ط)q0aow͌E?rK%0TR-k ׁ cgp>r#]1juޅA@̹ۺaevaU*MsxI"(Ӕ-f$gSoyQ @ ᥵qĺGuUT7yw#* ר p!׹x 6j`}ხ -ϕn|˳B6" %mhN1_FwoG#;"zJ+ue*!un `I"Jop|qu 'Pťmk'5v4aLi<\sYIfД5oGe鮳7i$VAt$8TNb N?B3K/9:V'4y|'y`SIלf8k>H+@wmvfB(ߘ}1A8V+=.r pʀy@IP>noׁ/ci=% b줤eFk{Ba.R1n JJ2}mMt)X^a.QDx3jO վҾҜuPJqT `uy^5@_^ŕ1w3b=ytz HSч\UZ TOzUP' -B;AаY)̦(`hJP-'3'D6B#+σy8놪j#=Vvr-:I-.JM'KT-vę0T^(y҉dVbeFpN4ḥ- / C(:59Pr,N8 )_ЊJL_JM'N~EkLxns2ei^ҽl:Є ò+ T<=uEռ<2S)wh[+ʡ75)#܍S|ZZrJ* =dG֤nM]50g3BSk|a +п%Ew|ȈW}T+fQ5GeH" hŒh.pka_*< y >x Ic=(/)NdƑ Lߓ?U2._4hj~\=%_j 8SɥÌOj̯"e^uIV+cm ~,ke]8m<}tqh9n>ORih1eDb8%=;L'ۗ-8;8zǝ|iAPWG?.K.96l}2 Z0/ V]yJQ SejG**׺`!oV,oŒ: 8vv!% !ӬGZɆ @뙥/REit2UqPS?Xl1Q5Ys -DFkJO imB*Ե,900I.V+OlkZCѨdz6ؒL䍿Ur{-QvG@ӍX5aA56F[۳(GR>:F[#vY!īZҽ oǔ+Qy0dTlY =ǰ/Uv]zg: !F*6k^qrYz渜&Sn.xʌ͋LX/6{bw!LJiD`N.G1#1In6) !rVgغ#ʻ.z>~v}JcNh=6&7riك]JSObvシӬ0~l\?>Thwl(e6CJѸmT,1-t:j_?k y y7M [lӶ+[KR-)Oq @~1P*Z-ޤIp@i 0T;0._g5Lj| f[3!Vo ŷ`"-ih'5ΝM;Aw }˱`!OFmvg"x.B+֎.wa%vO"RIYFj }{4 O 1T |K[#3R2/nY@ ^u <\( TNMI;ʵbjCZ`\5 JKiy/yI]g)Št%֏?vY'+߰_Α)[GaQ;}ymq{.@q1p]Z_D(+؀|T#HC1֝lo1# )O6޹kdc|`4ER^q)&h ! =I0֗!6XH^/uyuܗ)ֱs]cF xB5 "%HkjHoxi=P =zi i_ӭ(FO6\Mfx$sAD#=*Xݔ=((%6A\?)<s:mx7*Uf(կ* zjω}UHPqs0`EJ->Re2f@w) ֯oq"Q/Xa\Vi;8CI9j[ʠ=>JUr9ՇFg;<an)A'Nuo0ri=oԬWp pyUXv` ~_νjnݻ֨XK*iJ3C2~>T]M^R^O!J7N}u~ Ւ~iaŕQzN_aw.]0qz.a*lȮ*gvh+_ X?GaEmd!Yolpm.6pT).J-KkubIsUiw`16-3qKp޸\ Eo %F6r, @qx.`a%dX~\kIOQp PO^WPLw}u*m樜ֆ* G I)h tGowX٘*F-IYxeL"2 KaA(b;vK?tq1ZtvB\j2]Cu}%_ &E &\×$)'\Lanj_Md69!R9iOLY/ʤ }cE ,KmoB3aߣel[|;taE,I &{$wB&a럕IӨ$bf8`J@Oi|+ 3%ϭsG]9oBɻxy2Nh灳A5RWxkd4/Md uK7QGٳ p&]q3My#4~ %w, !wG潝6i;jyS(gݝ&{ༀl:U)(dS!fʜGw"&DMPݒݨt9bۓ8O7Ć ³6 5E3L;y2[ܜ}NE'I6+D]R [UF!jgDCo6i0r$@GsKZFJˌgYˏa+4s8<W~tRڄ￑+FGqQ382pyvqRRS_ x"4 UuF?ڔt V&$"7DO/7 bD`&q6*␲f/:>n)^#ʺeۗ9ת (tޢ=H‘cŤ@[t8^T4X\6 ^;Rjwg "Z^8\wF!jͥA[Hu0* jsK#3 2jTNUs}"ƍ.5,R{Ec_kNۺ* mϜ.8ȶI]ۮ &]C-Hûs`G;+8T2 "yˋm(CX5I!eff%hBTv;WwW'{8MS˗4m?J`;_0Q͛/ c?CMs$3Z.FR[hrBV*Af Q X1Ą|?J|G@ a :`j<]^ԍQ= ˺ 1}4Rw @}#U,xуoǍ36@,>'p0Bʺ*vDmgdI>ˁS",nSp}^˦O,fm:\LN6R2im9%(O6)7z'yaYM$@DxH~;h\1j*`ay2E© Mٰfϡ:|as+j2-1|ke6̋`5\RgpFkz9騜..3AYH/&hE@ X >2D)ưmXΆ.zsG9GuUn\_Gx,-9"ɴsEerl&%7%3ǿ]V~Q.,r}@1Zi;S9u9N\l4v4xJow[$H&\Ou1(I/,<M I=mpv3 Ӂ3~};.ׁKۨpH(f0ѓ+Chaiޱ'>qFzVrG,l T<8XN>\Y==] N~1oΛ `;>q`$nf6^ׄۡ#xndU}[wkf 5BGʨHe<3bVMYTւQ bh|/Aӏ` m!F]f}mԩY*h'YEDk@~}O:^ǬFA }V@DrE)"RR}*fDO bgbu]s[> %@Cke7i)C% sK˜TqFchx]`'"I/lhip zI/Oy=e O+zAFHTF u9 S#XH #:- l6e8 /y ]OdlS,t~SƳ`h% RB n0H>NhHt(6@԰\ZZ QA}E4{"|dGGCXmS"]ͅsм1WnGq][7AW8lVv FA$ءbR?[Nl `kP6V;RVf@~gN!-c ĻbR[G)-~": wt䂬XF6:\nI"双9Z7, |dG9 KwhEP yeщ?<"IY3Mјulv*U@괡<'-b+֯$BuHF cg(ծYj7iG/}9u=Sy:15V=ڕ'cBܶ0O5I [djу-F[.Oyyk]B>#k&Pǰٹxy/m!lCM~r57*oo-3,:7y9zǜ!US"lE }sGj14ZKMw%W XgRÙ $ {dHj:h-_}w-9.%,Bs5.I*> υCC3P_OmP"dD~gИl#HтsFN?)=IˢUf&~f?Mr=w[=(s#L2kG;u#dBzVRSU':'>%K^y$4+jtE˟F <[2D#S?pċ9}AP:;O5e pG,2:pمAp@ 9Fd>!]- xSĘ6HSTm zGZ.TP=E*$<`)癅G&8b׬]7@5iX)M BҎuk|HVyY5珛o=_tIo\#~! IAE|S<4%R'%|bTي6bD|2?*ɔɄ7#H`"<ҲtGYq]W)CӛpT Pe^f&s-b5OsEjՇsѾW5iIEQՆ؄Rgoj4S3L,|˗@̇52*:2sEIB'j>#~eߎ MsΏLB?~ƮT t/u&1聳G~StbL #avWޯAKa:-2&Vؐ*zOiTre}6GtE;3!N'Ivɰ o/x2t@m͜Cq*=5nݘOk[ yU:n>5RHP -Iڝ[@Ƞ✘ad),2!?i^ӣ'چ:$+pHʔ'~ph$ \J r(=3^GmkiW~J,ѿC܌bi;sLǴAx 3#ѹN7&p;fu/0g{J2|DJ==ߟq! w0)a6{d #9rV:ƀFOh*!' XY2 h{_kI|0lzp!h7$z%:M5נp Zś XeyΎFsT0%1g:@gjNJlEN`I /iMz9`h=C$Z:mK|T!x~,PRJ W[ƪn Z7QF$[.9h)" }EJ'"S֒L@)(j51KT;j|Iaf=OS?cTWX:ylL+ڇ6w|ȕơuN9ҳM*y x!mPh4DY]aTA_|PYgOj sQ8 SŘn ә#Sa1LJ1b78Ic_J4Pexe ~=tmèp*M2lqzcy]"¹BU0< ^~G-} Gt2!B8/}KU; <ɐ"}DiX%^: ;Scn!6ް&xڪ+Π:1V>'_ք^Y@\X/t ԏČky jڰxD\˯3RW5Ĩy i upU9,X4`:"P໣̆/sLWGl ZZ9a,$=9F7wdKբ[K:3|d<2OavNWfWDp ܔPb$}`WMքs.=}YU_ĭey)FYJdArTo*ACI(G$yx|$^IE2^ah2K{#4B̈-;T¤!&! }gE!(:X*/0Y^37uvWsC_:ϡ!-xvƊWWmyRvG{р.iV6B0"/I+>98k>Wwk=$(,QNanMe<ۮ1UE&Y<ɈkϮG8 'SC󣒄~|9 8Gz5~9pYFj *4.O~Ԃ9[b\)r8 ]Q׽#n+L)n w;aKYRڦ ِm.Gp(56{@Wf^0&GMG>{? dQ(^Rw@cTF+XY40Oƍ]Z: 90! KLD %0$qCP#mC)g)+VP˂w|:Z`h_Jm9_E8 [9RI^/VBHVIl?"勍3Rmn"\(D*Wx7;켎iB]n'7$>)3E䩙U{Vbyڌܲ 1MbLCK6?蝠&4ծ@7JG-!-{?NWBSD> H [,6fB;>RݐIB10 F MRIo85Z;^8g6K>|xZ H@RzYc(Dǯ=>VV'^`EkFk xߪ-3hIHs)&HFB"h|CpꏏNÝsS} «Y I(m{Fsrf|ljhs0\FtGDs)`k9~PA.O.dؕүvp 4jV .gP *(7B1ItlѢ'#7$u_}wZqӪ,[@8G=5ԝ(?U܂2 YOVR:3߼Ն\XO%:XP~3;0T(:Qvh+q2TϴXy]|9$)p`dRoat42+H1+SwIX*;/7|tXp_|4UҚkÙD% EV=썩7ssEOvl:!8v+N2¡&o>BI{ O|_9tx}iC<|"%cZ!jR^HM3 ݖ3PiBxenV?rT9Xf.-ˇc㞔VsEOc@Y]ђOJFY-Jxc 3M*(M7R݄AHrQR}+(HwӲ'?x磹?9?ȉ:[OEY|EMJDbnښ X[w 赵DKăd]b{b$ؐEZbJuU_nG!O(${㻲p([JZ+䵨rnDbq|~tM%sB y3ߞ~/E!&/&]JvBըu6Q#7זq[ Л72&.hYkB) ]F[7+aTc#W.ga@ g8`[ nesYaDy%(B #qe C%f8pF}wV]і0jR_Df =}Dzx춲[(7,"'}ڝN"p=pbRnT.Ee+) ÒC#ZG![ԼILٮ+4hmU BdGʉ%aHMC8.T'G:!6x M49x /5R BQgNat v`\>.dzL#]`aH SƲ duhWlu=-hsU6i9nll,:?]<5贮9SC3Xp7AnEǶ2LjO_cߤ@HZB}u-}I @6@$ 2;O+-&J\ejHK0e}2@0b}}Dgob\[+y,hwI+h1 3DEY.&P^gw@ב4-#Ga?RJHR@|)ԇp̈́Ҡno! gQg 5 b0%Ѯ:eSa‘> V dsz7LSvH9y)x'e[sDP9 5df\rYFQ3QAH' f`=8 Tf8dc|\>T hl*ƹN*={/9*)g!S:>Db#ؠj~dn@veT$c7,H5 ͇ 7l݁(t4oMEަ7%T gHrRW9r_ vO?C5y;'*3ϩ͓6f_Y%z+Q3'Ϥ~bY+Q5Ј?rgssP2Ӡ开E|.;Ej%v `* z1?~~DLOƻ9#Ha)c4^ GT*# ZTrn \{oG28bbreTR-ъ]mvN󪬝E-SVa1*^xjO.%B$ \Zېg܉6h^+a18 I2d*gp_&;0: ǯhWYtrȀԺ.V '.q &3Aa\~ ) |\Jx`k=7HXt≠8mBYU^[׍/H7\e^_d:)G\Cc*f:ѢHdKMw+M L3P>V@X kw??/4E-kHVc.hC XvU˶a!wP6KYHO0N Kʄ y*q-`єՄj48xF(i4#_r6:S%Iidm!7n8 bIOJ:܇_q2E%u.ɥ{-Hm$\1CGxwxlWտ䷧h"2n%\ZΪ 'WsdAXܾ8ӸAzncM &Bڛ,M6a!䏉Vcuaғ ٍaS(! `Rtԁe5[mT36@{R5}*,qPE;C403P5|!Z8# *XRP0@Ն>PX`*1$ ᎮJ\W<$CB#:z* g(͔X0Oe8J[EM}u #E#FO86,8w_hV)*y{m ȻɁ_N 4/Nۮ6.hh NxLynzq!~{v5_LӗoO-s rJÏ-q nf;-ICfr@ϣUJ0@ļ"f;uj[gc[x5s XajZtZ qMBTX"%sBgۿ|/Tv9گ0/͜Oj%B{;u@}x=Փ3ch7cf iV> xUrhh,5AV Epݖ=5g`(1ά9V jАhUpŎIv(N7WlGxW7zas\#ډ[Mozդ[޾*p\20M>7-u6‫v̻3H U`(S\W8ls(3t_Du_!saf Ő%3G8%S'P_cZ.Jcpm8ȼ"S7!~ oK&^\cX?0pþ|AJ \WBXh¼ 56zJ3{s vߖ3Ul j9 Ҭ{y%RK8?ۘ*I議՛D 9fGzeed.s> MCTy/^%>Vݬ~T%< @3oPC6k|H V+y*򙋹Wrj=Bܸ6լP&Ek4?;>}}z~l1M;҈n&|<۠L bg }R5H _2O4SvJ9>_ }}V0/')!R -ܹ@o5L%S2k=g=cɟZ죠;֛˛*w6Žfu(b }ࢭpV9NO+ f( 33 U4մ0DYw?E7!p1& {_MNGT}ؠf| eA'nm˝Bگiiql ZJa#%G`AUhGxYϒòiՊS3 >dw]H{ifK y);Hi G1ȂBbraC"09su SrCf:sN8|[iym] 0C` dNg,3LMyo-kSnURi@ ,@'$+c?L969fwdE0/VgD8$}[UdTQw"SƯu;<7wM eM",ct (;m85/jר|S3R΂1darR, mq)ʒ,oMʐ8,Q_)ؿVbSO_fCj Lo lARi q\,ZRVw,fNw t0.~'% RD`Jj hjҹ է gl|3j"%ΕJ嵌# yOV%x v:=22 kYULzU^qqVP&WUb\9a]Ĭk .0u@=t LYPaPՉ0i $h櫬$ [1{?@7!dRN1>zp㹰P; [y V4N!!J&/ B+,{s XJm2Rf ߡvXK )R8>tĭ"`:' v#VHˢ5@mamh%'?2Љ>sr7 1s& p1TH(k *,CƂwQ!=GnuJN~?Uyic9QA]\}i{ͫ {t^atNϦw xX7^: Wǎ>LQwUwsʾm, ,Kĭ,Q+J<naC{Ɨ G&*yf7DNh vh v@+U;y\4{*U錱ӯ#/~&0VE`p]-׋m#4فʊh7mc<`)HtTÙh Po`0ZJ*HZw/茡˫l_('N'O"$yqJ0"3!:ai"u яVv|*RJ%Ȱypo;GүE&]Wy\+d* ؊ 8SyU3,B* /6݅╒Yk|E)u3S$S4aw[`:,g ܪ}dtwbvk0]ޛ<‘ Ӝ p }.յTҏ@y>oWI)<`\˲a: 8={9Ik `[[1s6G-cnzG$>=/=B+r,Ǧq̌8<4=y5Kuxl&Z R@b$ʯ_7,i7; vKgq6|K[UJ. @(S?Ɲa/iP麘@, mg jZ?RAOeO!:mf󬹸G&tN-ěMέ7Rfldl(EVQ79ϝk@9``l\u\l=@`'BbY>2}w/3}!\Y.q}jxj/ v!7}6B[dI1ŭ4kσxK11]z>\N_/n\t2 SP.nQlMdC ʃ1ZTeR)iA] !\ י+b|..!nX0ߘOSz/}Rw»+K#^(}ǁVԼhHd"^5p롹ŭuɊoIIuTО5"|k`/R9;[;Ph?ӋQ\ K Yn\VP2L~֙qHuHMH܃ZߨlZ'Ť~oOZ8rYRƑ޴B?D;$Yש0&Z_0 LHPQ_(#qrc>7/is_^qÐ Ca SokU-=ZPڥ2&$o aRhM7W &%h܉N'11R%נtbZ9}1,rkUv€[usr|}#~EQ,Ri~ Su!c$̏XҼdӹ|z-+JO\(${{݂iIK%$r4;D„sW UJ-h8ι=PY* v+QĿEBv4)&I'\l.>?&oiC0q5CGѣw,.K[E\l2*lAfMlλm=pdn=h cq{2͡qH&H+FRa8rOd@~_^PA&c)w̠9 _x,U"VA{ĝRĹK$r`e/fƈ ٳ} zUQ #z돐Z#TXg$EXqRKpӆKwI2="kE֦+N1-G;UFRDb1YG}6jezvHɯ)4SQ=B2DQfAe;DpW{+Q-΢KͿؽ/y6k Պr( 3$L$*5,c"4O\N LQ&o)>KxE"\! E=@lIn AHBڿ\~aQֈ54l |Q`,~Ӄ/g [']:Ӕ>j`ǽu7@ X>h ո&d>3r9? ]+>)Ҫ("s_8`?S"`o4L~bnd\ {h}Ӂ/Bq 쟋b-Tku7ڋ[AkgeJqX+s1{Bc4DG)! ?օveWW"h숋4׎m`Cx1SI* %Ŷ:ti5;kp̎%ʧ* >31b᫪/p/i;N^l)[x1?fcNW^kuvF\(8XB"#D]aH_YyQh5XOguLEyE- .Jx蚸ae7In|'űg30WSbQB5veEWtm ^#hy=x2YW'kvg{)ώ@<  zn :<`ߓw@vu2čVi(~TKMH+CO- .Z)ghb0`|S:ucBh7T<68#CRD sZ(]ɢQuӫ˰-]pMi5 UNoGxS]9&G;ogI6_%R2xDJRJË~bnP,:bEݟwO^t&4!«<ͽk1 Ī2bqiaD1k){!x0gXk\X&|>X~/}-J@ 6 #7Wq4`Zi׍$ok!{#%vK[Y_BR^X>u%Ð*АFZi-VYULEڽDW-u5 ghwe歄ZD@!K2ha%5j28vzV+]d`D ־$=f\oC~>MX ~ޟd*y>%{hv6+QبOsm\V.oO 9Ol"n4F菭ROXr9uq=iHnd؏\)1,6VcHa,uK"J#J>L\7|`-J|NH⊙ZzvVB9j{]Ш+E#i UI+tJS ܊DhPȿ*Kض^c7ԧ3?qZrxC%* AQݗf)rAH޾Ncg'Ԝ}bm9rPm(XWΈOitk[%6\yy>:euFX4ӇX 2mhֹI؊Ƅ Pqq| 2wkn ,!.ʢ$OԀ.~D[~ZAW˩0׼ꖩ*vլu}5TM;}C6C">p~SN;DODfY(#F )?V=ӳR =ܚc}n.휺iȵIB*Y?5gOG>0qomP|ցulb jNj/?wp3J偂OUG<݃&!LѰ]9B{oގXȉP붘&3zI|T!_6\l Zu>!lvk7G=". $@cc)O?МX >V0S|cPްIA875&cHs0&E[cksD΄`0)Em; 1(*sՙ@di)Bʜ!t?lM9mۧ͒Kz݀sšw&9V<-A|G~/L;tm?=Wh]Oډ6FۣVtLyE1<7(6 zN$iWe7C*O,BCDUDs`"G xI:ssndOrWDpɳFrn&M}͖7(rڜjW:}ct}.mB C]QNz^os C4SO~3f+>Pi>( %:r~bկ1/E֮NHv {;+OoϹՓ CI&Mu$vmr)OՖ7F- '' jԖ9Ƒ˥&LCT v# I'HYL[!]t,(ymP13B?_T{6b.rTto\/xE33]75h~iU}BpHxdO^%D%[R3RMdlaMbq)O؁,: z6$"^C|A8TDou^O˓1쾰A$+N56z򖪉;$',qߌ A~u6倡Ҹ\ToE\0{9dŇwBW.5r[@ rŤf7ѵ1y@VWvcNAIgt4d`b3Pp HsqmD#3  va W՟ 3MUѱv^x$<^ųE: 3_ʍbSOW K*۽5,Mъ~حow I yJu@rs,4i\1iBTx(J?cT8q.~VL P KQlAx9\ xraj$TfOEޢ!&M)2R &l8oXE/a!~`48FB#9RFStˠJH!|6Җ«|6ϮYQ"HfuކמB ^K$-COe/EbǠ8#.ok!3"X|jIU=2GQrѝd&X 'MۨwrƸ-_=uYɋGP{]4Lڳ=(,n"(La3"޴"MJW2YIl(є>#6ԄAX3ɠ-TrPB8U CZSHQƐЅIq+n";SڹN%ZJѱE+"~hz>/AF&,#ɿ~>Upo&Ǒ7s+4J6A#~R%3?J6$NBt,^5IxAQ \ϕ~hmD"[zrvCW'rI)e'.^:0{⟄"KOz(^fRRp >k^ؕa(_sdI9񱶃ocUCGA$NMʰ)zMӏ_3" "6wBGRK!vMT&1SZ}n\ޠ#Rxi5.{Bol5~oMOr9.`o!f2-;c%AFعo RVN F5g'zoBZ1"U}P-Vt=ǹ'JrefKI@ٙ*5a􉋁]kik4e}hWqSˡHoOgѺZ؎\DoviMb@%Ƞtqfkcr$FH:!p(Uvb)ZQs P>=WhmU8@@Wc oh1~{ v5ex]i:q:s͇"VlVmC+'-"C*8K^489.şCPg:Iaalax8uq ]+t^S{ B5Uz'p\+ Fc v4K5rPV93(9}}=W@3D$C+IHl]t:ozhDYA{̈ŏ8-3(c_{±U^/>94`EG<\E'07ML$ۅ]ę0NcC+UV]?p{#Q}BO0ډ!k76>S Wٷ)Xڪy>&Id/KEO6v 8@IBZC;ǚb&:ǪYvox}30y\'= YXoɁT? b`HUsebe~ȝ-yDͷ>muۓO"G? !S3*\W_W_澧xUO ˤU ;ȸ2'׻ Y@w 30 nu'%?+՚ /)SF(ݕ)iEfb!vJϪQsZ_ /ŧ' K\*KزVZ'بW %<Ňl?AE샷1pdN7UynL ȇpوz,WzV۩^!MdU̓U";Jkr,&0sUKi>qs.RjTst1qFIY"/ .mlڭq!UUBa5#H׆i8 vg*2 %F2,F}Z=+az>DʵY/QKusAV:w%-%IA U`]P 1_s#F[`G|~^9!2g; qcr>R ݾߌ'h`dx謭Kq+T/O;WpmRV։Jw.i9j3%\^&Pk܀H["{ơ(Q1-Ph%NXϞ##D=Fٜ+SW]Ρ6yX2yGWÅ!7HeSע}&)#X__Cgaۼ'<\"~BU@4fP8HJ놌Ef6f ]|Ou.Ĵ[% B&ڥ i1C|$ݙM;Yw{k4E/3LkN6޼hf2Yzx< }&o~m/f{wS!J"ڱϣKq-ON,9Qr8 ٛuڎ}n&rѧ\aҡ&Hcco$ "s=IrBR *0X .:?nP >gݪ$<$G E͞ QG߁[]{BZrIkvd?"v[EK%1Tg zw ߀C9Y&~(C98Ry*|q.Ha,4} 2n>'<^.fK)[ZUk~ܕWfT<)xFP&t t=ĉlMd,ㅱ6=kcVL:6哵,*.ri9@Ƀe5SV HNu܂Pˏu՞-xid䔓ظ' $8ob%"C%>j' kfO($rcR!G36Pܛ_>)f8@?y8ކd3 tl]E RvAQ`3B,l ,s{pl-m)g bDG}(5ڍT4o V@F b;Ïcjp0/Cy ,m::me\q5˩$Ȍ=_kM1giq&>2-]b A?"C&A @)."/ϥԬ{־e1WʯVKה,$<' ,R|,m~*_0ͱ0LUrɮ_b[=G-m K*K=v[h =ٻ|;c32!g8[+]a< ٱ,rUeVnp+QdzuM.D?uJu6n:IcdMNn3R(M@+CTb4L%g66 TSAʷ X+ՐpCIM0ȥsN)6ayDm_,dD~@‚* rta)],|~xɫT-u_\oky)a{NU3) "dߘ/~DcP{̄&xeAZ"0*_SÈYbQf /0Jn:zb4 Ό % `vU܃x)xvUIe@v3o:VI;dSC.2 -nV-;V du-KDŽJ ?@^ wI޸ 5>xɺiզWMj$/M3>q 7ֽxJo8όZB55=F~V$DrV|?δ WNLY$X̀Wv5byAR0|* ?@ӧE_YxaL~Wkx;2#:ƇHہnfPupWץֽB('I6gNܖ@V9.xNZ:fȕRhӀƂ/ hލ'BܵkвIEԐ%s$f7),~1FeƁ~4,kC7IXE"эbrR| (XՋL \nd;>E !_dȷ?9d N}Ok# g)@I~"vd WCvbpͺ;|mmJxM_[7fh!ǰp[0#W}䳃7P9֣^f7U?iٮ#&AZ v<_a6~ bOKzkβJNQ@O7aTgG*6]͋ńܵ.YU'Hj,ܗiLRڌM.ʅ&X+jvY5X>R5J?1yn{vܑ%qfYP7Gv  "Vyuq^JF§}d@|mR2ޅ3#D)_RӿQw:Gpn4۹uœħO<=4*fC'rAۦoXpE8-ֻ:7mu,{e&jâqdE*g:K?ǽɏ CimQYoba:-G L 0Mo-o?2 d)L@ot=!+_Žv5'bz\ L,H윺}.reY0Tӽ }}R,{M oОRͳoa2\AFbSAFߚC_:͗ަ EsYE/0 yMy߀ qE윮b <7^q$ ,2X&rKHl61AMdpǀ k4 e{yvexB"ٕ b$T-d?hgZ 9S*HdX+j\ϝe #IKg,IܺÒґB*j]rA  d 6cGRB"$K-6d9edž_g&ѓ/6!WBa*]%MᔗH$/9v&8/BSI4ҕ8>zLD.3 io<6'uE^.: lfOoqLSFZ ~<뷰 ҹ\鍱C]!Pb'AHAj.7d.'*`]y;h^L[BK''.uꃇٯ^BBjzҋ0l[a5kC0w%Ӹ1,Ԅ_8{ОofSPŗXЁJ,Vdf##fzܖު`389>9ynH1vM  1BaM8ĀJK٠w܄3Y+՞ȫjAW#@-.QeĎ z|+G8Vܚ?cU%$/?_(OhLԱld^ld;SIC"/$A,lm/܍Vה^*7L'0Ng>\ <Qi@(>AaR/M?&L ,#Wf#c >͜U3 ]eZ/.T Sn=lY}Rk ?]KQ3tD]!uߺpb+U Đ0; G~oeW uwd%"em +jQg63M[Ɖ"Ė[;(>f*GT-ol_(3H- WqŔ%Ir{J>QGٔluuxlHc@?u*ԇA}/u2Eˏ7 յ0)B~MR$}ѧSݩ,E8զp0͉';R%{MҿAlx|\|e&wޭN8-c! ;p6}X0g)D|_ݥJ h!Y/p69D{\NlK4Z6†]8q]TˑLl;ֺ$uGdC;|؋;c3) Z7KbRj9Y|NHX^.گ֯-Saw++G bX܋mصƈ8_OqOH>i">O<7nF;ɑ}•VaMN-Wp1UBxI(>m!bh TV0 i>(#m4S?S ޛQͅ%8` C%dyMIv\%0{n~tqUL҅zj1~BLwCH9h*ٝw<k-kspJHN7E.3B2k`i*8A߶n=qק n Fq4ZKu~:ԑN x%@B K/+-.D¬IF c!cnڟUpFJSRz N9Px`y4lsN zB}!vZ.QW[~ԥ:rmmUEUO~3aN{\`<$)TSn[ qs$p+O?D8Ul*7X!9)t`G7L8X=kȴZgq&&TeiN6V|T{#B vMÓQT#uޢ~Q ?@CTsgy?/hr3 N3=Ѧl|n[OpӤq-&/ɿusS&!Qc>UQ"n7 qNTʆœsm"̪; $PƊ žh! -'/v%P0O\`A:AO Ĩ>4]}?[p{͖-"n'M_[ F-K,Co6~[yI~$wL||aoƟTx3x|qM܉Cj`%i-;U~-̷rѨ{DxfGgK%]p+' ޶j0t~jXRDsݱ~mMVKFyVHZ58s KՑ1ч^W7$(j:i?:P;Acd=FWƞO^z޼+ +G8-v۳a:X`e*WWOpW;]x-@61xUw#4ԇF{Mm¾HaR|z،r_}} -b\6vHayfTWT_EȁxiC7[#k{>T@H]#aY` T{"9G^Q]M_\dmsMmBN!u[з ƣ;x%CV\~!-yu?3Wd.dHP29.ثDg<&FA?V?w8Yr:Fn~޵eW^M*sˣKjI8WmBj"ܸNzMP{S|-Mm2|a/\a=78&jtGy?Z޶N J'%x~`_}FBgUq'2MDM PMHmruf5k O;o“8J'#V=xpe(,g'DFq> Nca=hK˨.9SLDD[&];oU,aW"|hj%X a0j>}AK]oNJ %ᗝvG1m>x(W'~iz!~Dzl7JY$Z(7D&@j%`KOPN_>BfO?L#…%|\`xŧ:R*rcm+=u[­No Q'qp&?46@V(E9׳qH$5roYE20xcMP'|S0Q!3sږˠ)0I[9`M Ohv(}b*NI~bq#Ϧ3x-H^]Y#~|'XC'HhbFighFQ&ڲ4YvVe~uۃ-9@?LH H Go_D-aF^HH ۍ"zNxnV-դl:RvZ֘ K&hqEߚ$]'YK W4[Gj;x~Hn1T2drC<\u8ո'Ʋ1ZZ6z$F R]*A& Skh'rϨّPvFq_OTԐqΝ$~BO@ďw;Z};kK˩vxtX(@KSÀYC"ruXG.(;Y=I֢ u@W#n\5م<c. ,zgDzv4n3;UlJHIFVdaHat4afw:Dc, Fbnm7>ep8`J^:Nb?y鸌ncJ>{.=X/{!I9YG7ykw#x-Q CאMdœWA}e+eO( '!c#=r[J[f]`2:5*$ՔϏs,xfwUo QݔŲϊ!2 Gӏ~B^MRFNg @H&8B{>Xu{VpA5-  1AdHAr`&BHT/--y]ޜ~ڄRY, H"~Ҿ*Xn=zbq[M8pĝJzl=Mt0(d(fMrDF1RH-v)xSy!6IkD<4 O5nmf@^<1743gؼ ck{܁ (WlY]/9jI5uI- %Ph#CFhRM>p1uƛpV76עv!>R|4hb=Zuҙ9|6{~:aV G`Sao }TA(YZog~Blc 6F1Gb2U6G:P=zt2gOjk}e I5gf]'-b8 ͉Cْ* /i 雕썊**,%ǼS^5-03,8v`qloϸ*)4vɋc_g Ƭ}{l͆{ܩϖWxm{7 kxLג2Svy>v fB-Tm߳a~++?ٌT|PUdpP P{{a )e?—@?'uWM_D2]L8…]w'E -b|C*zX`D8z':, -uQ9)lo|ͩߊ 3SaoX2-;җ~o1+Jte1gJ\>Gnc4HӥQ3fSCN6H)Zx5oQu}KHvĿ["CeA6GfsKZiبC*g6EZ *?6OVû?g8yXW QĉY- ͳ\Vy0>1~&E{yi2 qZgBSEoDpjaͅVqwS+tRz֘Ew_;4 )uЧS[S~Ԛ}jY5w, ĥy.~jY@bpcgLc1%JӶַQk̿W=IrF1ǸQOB@]|3mwr;Lq7$)ux3>f'/SO%ќ3~\T$ 9I@Xa 'cGZX?eB6tQ&EtT#rL k涡:齣5ɻ9gFI] ؽ g-D֎GZ=͵oB<%Cb?pϣ俶S;.M1 LXGX:Qb*J\P,Zq9:~%Lu"c٩.)ShVxRq7͊2ep(UcXdws;۸ׂN &yK"2Q,Q0iّԯhH=3Y@.t˗~Ffu%u^\=2:I5tUq)CfƋ[6fD`ĥ6oܫ56 *1rAQl f/O| ktk;y=F|C$$š9eaܗ;Iжw(ў1:Z"QZ#T#A}UL/te6Mt2QH&/8up\'o}vˋJz,'WbO1YuYӖ9aa- +D6r)`;;sw,k&Ie}  @q':)_58yEIZ) wKY> /ͨ3VhwM/J;瀆gE˳N&n hܻ}+i^'t=AXJ^mG#aP?GnnsHR# J_u }٬@~G8Z`l' m'mttڗ>vn8 dӸ |]T9  <1E/ v?qX eÕď즺0rLy ۆk7E^\\|Gwx?~,=,?3-䑝4yXdk t( qpg=NE]^+JVG攴Y3(H{ػB.;LoNYl^b9]ΚY2wYfwn d+(~dG0j =~K!FK sG6aU!GąK{xK >ol͘r&.˴"K r 1H,")nBv!3@iqD3HoX MCT_^`oyooS<58 APt~S a ${xU>p`.ßr LQ`H43K\4$F(0sM B|bzz *z';l4zK?P $@T@D$^i}ӷR?v"˒] et*}z8i~-MC%H|}Y E  ^0fMJ"Lh}_)emH<ʱMv~tšf |6[M0@O~ -Fo 2Są9JFQೋ+j3p.8%x`QS['%ӜV@Yo]]F-b MjfPg{1lWBH9^ Cޗ}KA£RҙzIߧ;EHH1%FS̖CNع+HQJUh@:jKViM7Pٻ' %H'ƏW.=|\RY*)h2x{Q,X1ـ%ߕ DS ObFi[1?/Ht4̗$KXk!-s5)Lrucf| 3 ہxV]㊙Ls<J#ȅJ1&|S: Sn@^?+ Cn.9-3oו^ڷoR*;mhR-HJ$ &.ڇܷu7s+<Z(ݥ/=m ~ԯ}pٔW £RܶQNT&>˙d Y(+`t1b-)#f(h \& 1Д&==Ύ`|YaN >+/%¦=O"6tWS{YZ퍞ۺ)a<ȊO o%1X=\' C4Fj!x"JKAVR#IO gXfޓRR"SqGwt+׋oE$ _j[GU3h %I}D8T0f &bC!B\R,".pAl sE X!(jeD:?vM|>C0KF%4GnV_>4SLx TױrxDZ*gټ .= q ]͎<j^_S2grc˧AL'oj]|H4>Ʋzm%iĽX-9P84hV|i(HE |ɬ~OEy\+1m|mS;X! |SjRD]ұ,.?Qr,|*۰o)n4ot>y1DaDcteUcxYņx)bytyy=~r(pߨ~<~È$m) C*s(V9!.]*ۊ#V zZkmuAAlȷ\4\cr=7Ky[Uep-\&߾If!i'N֊Q'<"tȔ4.,PRW9_5f1b@ "\~6ڻv0NAG)(QFDc- e-c"{]^V-b—PzWB*L2\:z:ɔ9ZĽqPSC%b$5`c~:71 Uh/Yһ0kEc_IG*%A8 DZa냌yk*lnsѰeEYi$—sIpOn,`j{&ie([*#+ьSkx'~:BO W7䅶cqs!1H-!Bmzݣa0t4JCڏL ^Ԍ3Iv[?4u*`˳ȿ8I6$%Cꀂ{=\O)i;j[ LHr6()~ 6& U`?m0"f sˋqְ}EyRMDvB,f% 0@Ⱥa>ck-0ܵ4˺i0sW6Fm'6hgLdȶw :{ųQ65CNaRc"SRXfÆȫb7[XuGUѪLr4C去EjKjm$PKHySPpqCvјIH4!͒Sݑp̡kg9&Ψt_݅{bB6s L'&1OHɑDptV #]L^"؆9קd(c3~ B{Qnb\@D:Ά|h^6X('9sZ-gqh&O M"f?A,>?v:J _B/ Y7چ\Bj8?/`]~iNPr_{BOSU(rxD1=`YLʹn1ܥ ޅB*vzZBнeN>fww7(Ō8m[i7e`cxIICcX7heWVp쐆; 6Mw\:_DIL*,!CaF#Ln~Tzۋ/|-~s="l6˰"ESjvRjRsNiyFQ1V~i 0< #K0= ޻tiƴ"_?\\Ywa "6u=(7bv#\B]iw 4Ě:b7 T)WQ"TM]c !g=HPBJ/7 <C20XՃ?m'QO xw%-"' 2.Bk(\' wT4r|xzqE;v;5-pN*ipa@!8-c(89P6\SYcUhht&T '>L\ZR0vSrN,DΣeZqsb;AAfiY nsغPP_Ԣi5(V[jQ˨uZ%E^@k#H~iyѽ.]e!'?U76e@(Ҽ7B&BnKCL{}A0aؕ4[YJ$,{K?Fz}|-4"@.Csyd\t)LB;%HRkgUcI?i?y8 ג~ kΨMŽ23q._ӓ'jfYdB4X}/.wB:_ڈ=9r2f*J:xXE8-ȻUˆC.nG;dmZB+= hrVe_Domo/"A(nMI[Usn7*߷ZԣW+22 m^ x X ,j \t?NP Y4n̷#S4՟pĿ$MwDD)wH:uC11\0kQVƇ}CIXY"A!oyy135# 3%e lʵAt>06\)UU0D3ьA3͸PCmyo9=&\2AfryZfæ#h%&Y+d*z:Z/,Z@v!ťF E'b-TPҮ'Ԛձܒp/V 7=x1v,ߗ̀XMN2xk, ]'xҝNv-_o9fݏ Juh fW~t.Ȅ&-Ē*etO<_u_f]hf09Bw$60] 3'ԙbPAOg}]L%~WjTz:a(2 ٚ)ihǓwMYrͶ C_!o{G@4]*+ҝ ~CՂ>eHx]x}tǠ6FpG~| ^EVzt fAni*1OAf|vNQN'v\l /Q?1FFcl0Vc _]iIQn&Oc3xMu}G >684_%SMV`t-~=>kbF<ǥ( qi;K!<''pu4'8DW7o|C_f3ݾ25o?Fg[z$PXЩR#r (a{N1^ݻ5CEQ ^t9i>ѻEŢyFš} /?-QAn sjKSd;{΢upmlf|D,)~j8sYO6M| ã!)hu(W̟_zma/l8 WrD?[E&ȡ6-|5bkb[dqFrAP@݌"/~p:^1[fq'NTȝa>^~t!bZC.JH1ӑJ}PVhEXV# Ln^s# D1db"jR3C:wTҼHfԞ)["Pm%qYRYcpqp9Eu"r\ 7Su#]<+=xNo;G7b{7\L6d#_]NzJrm )Ɔ}mGLddu%Q 8Yɱ[@Dm[O U$3( ;.x9쮂tJQxYa2K$O x = pʧѐW*]&%@bV lAHTc cgnin9 ϒmԽ+9/l8ς.a%^ELF5( H8+̯֕vem7'Ŗa uP ϖ}]ݥ3k$8#0349>8=ҧs dM ?.q36PSeqC:v[r{Z~Y%֊#LI!A&C(pl?ڷkUaPqQYR[NvZ]|Xpd Vfu$WyVH, %\i\5{!w __1ʈ-3e()aCs.R [h4!p3OwWPLev $ottC3 "n|TDqƻyR> gLƖ\ C.qEF ce+=ӎXG&:--/b✐9lS20|{Mŭ[.b3X\܈ b5ômˡ.jncW-z2Y8UޯF*-uYJMACrDEI N0[TSzB4W0]s,]SiI{ S%Ӳ'z5^ǹh),$1D4F<{6oavr?;a{Ơ=$`tgݕ|W}46J{dR97l,>RGP\ca}mB19u k9/UhG ҂8ހS7wR$$#Cdg)`_uWD;}M bގ,㚚P^ץgNCS+ҟS|V2> ?{QmhH6nKH3+ܧ\0x24ppȷwQgNDwK%[/^Z/$lʊXS=6X29{+RS nu⩳ h DQ%mub+-0t>kaKL wBvYTÂp?0QwkJt)⦌NY"$fs |8x15[Hf5/4=ɟ;ޅ|nvRYG<2Qߛz/.=wEԁM**h<"r()e+9Zjcw&#nywsOVO>iY6h-bO ujֽWnjBjde{16fOWM C^n{e7O\'v^Γh/)β@V(1^;P~8/!{>yR gv\'nt6he1Ag.39gDO[t5[^ L`Lrד-B,,7+Z 8,7r uFdQK4a$ݛoRwo[BKš_ں0vA1Ug1"Syi;=sb$: "z~77rJQIkN|=eFU ԗ@H6k߀CwֹF]AH 8ҹ/Vz+4m9θ|UUb٣8簣m m $ʸXՈmבwcIGO֥渲h^/ػ`PMGPenJv`SX4(=қ,jCtsԭ+)ޭ%^a)ȞI ' V5`97^$;ui>D)Z .T?f"aπy*JKc%_rf_|rI`Vq7_s;qnK94IYo=TlXN$ŕy\~4^nXS+k$4ϱ[c3 dGu LW&mVΓNYPHҩ? h+X,9~Z#PA +1,Fܡ 5cH@C~8Yi_kۙE.)ov1lPʁ*ͺz7=ھ,0u>a-`' 3c%48 ODdFb@lnq*{-+J3zE`RSm7G"(N&LmJ׀ZWN)Μ6͙)˵Pg5cQ^& @^3+) u`^#XmIS_Rp[>0Ӥ<`M${xVweMA2MfVhɯcuQJ+MףeZV>y΄.`V$,-v_c,0?8ab9Fn~ρc0G8OaʏferJN L5bv땄ڻ޴V7/&F&vK6a!HUop&x k EDiG@V\AGf)o=xϣNv~]+^f]݄8PPx!N3| 2 jbtf%unw2P jzLp kZ*ǭh[;Y87Qk`% -m(q^d݇ u-"쉺aQF5CdO,Xtv+k4Lbx.&o?2`4dt#e"DEf#Z`BʟSܢRe-zЩ"ܸ",3s"^2g_\tVuX]L.Gb{mNxYϷg|Θ7|/mJ3s reՏ?yRiBQPrP M=,:yD­9qZE3Zv|.Վ9u{ЉRX?lŗI#0u[Ҋa(/{McEY@䈩yiٜ ɣeMn!0]l w?r9BѠ(!J/b>UGKpy=&Aˇae4jA%s{ovN\asޠ݀sWcu7{M6g-'b*iA;5έ p孍%xy 'mud [ONgfj\?t<Bbrcx?!#w,6-= ^l#[ן| UĹm5k(~E\$ oen4~Dz^b%KWFuژ|6lbkXyw 2uڹH%C ;CH2C2+)E4u0fs&s9 #̸vi^&J  '~Ɔ f]+tnP4hEE(֍z"_]#^ sLv門֮SƆ!H,K 1PM0Iʞ7mEx5M >HSԜ.KLTD%o[ׅC%|$|_U,<un('uq~i x})bqnʠ2v(IPr*N3zڜ]gpwGgPqe@i_IA-]%ÿXT}Cs7x SXj$J"}^s^0кWl<\rq*T{xJrn9'U|P!ps Xg^;l%<+b2tpE-$>4\Gټ@z Ee=x?9JV%Ж,,3tk2߱}KK_TeOЁ83ֱS9{@AdthΩ8;$QE"'aUt89Ej|z:fO@( i3XbzOh#-h¸jݼv 'ӈR,nù3m2&9 L/^aG85TWcm*ja1b@8kHD!sz x.Z0hgBXSs`.++E"־祻zK`zh lF2?::Nك=97DMՎ zf?B{$Xܭca3-[ˠ޴DS! `4Wx ,UpIa) 2#.hU8*z}%80Z*.5}._y~5)n>x|2+*=uDr b',*FQQ?o':ok?-MmϡXm]mꧺ32g8\9YBkUxd_}=iSPL#׀eucFp>- *$*yg=WscPs$;`VL=]J|yw>B_0-_r'`|nWl^]:;+RNي zюFsT#@պAL=HN+zCB(>z{Sm"xe1峯/1QJ&!ؘ%4=;M'(6T <}V2!\t{g jm)o/yn vwR&%fّA=10Ӏ?7fw_ L2X7\^ȼoKz+air8MYߞb ]2u@jݹBu1w|]qB|eĈÂl:DVj[CCXL *_;2 9lQ}vp4d'qzy)0i;.tiS_~+KZQkbaBѣYpSع"ev:K mՈb5)e>RJPngvJ~4Ь^v[ 1R찫5`4vWb@[B@Zd5t,vsSI\Ѥ.62oȠ?=fQ_L^~c(c9=-|Z/li+s,=غT-2ILoF]l35L]~!0@%-8кf8u'b.%V; >+[wKSBOј&C5~RAû60:¸E8ߏIL2(/NX9 <QM|w݉+ũu6ess`*&IšWyOA,ݪڦG5<OTĎ@YPۦҲU(YlpC`dK3M 8sg PiyL}g^]j5^[A-n,щ>a>3w!ʯkg`(As)3 ߅ 6!\|?O8D~'j/~ )zsT!83BIQT4zTRG§!l@N953[Uk,DO-а=\5ZؙK兂TIlcHw3JNB`Ǹ>vT S:/M)s(u`qgA;+x nЍ!$&G?8G@fۦ[{N Or??2+n}:ݕaDgiXU \Lw`3b?9{2hxռWTyފ1N PM7T;aG6II(+)p*_i șvGy1!ϞMY<0-y2n\M>1p~󥔀0GĐ2Ym~ GFBca Bhy@~ k/Փudz K7緄ՌMϾbe7(,Z`DXZ!XrsoTʉwh6]lc 7DƸm{$F\4kUI3vo@[ؚS3t ֈNߵYZQ*P8_ @ofF0w]i}I1? _/*]UViS5iG*&P?ZD6>؄`5}ұ 4RF^!6(pOh7V%U# Hk&/  UEz7i*Ƶ8oi Qt)TܠtTiQc.(7DςW?qf%` D{"]0Dkc-Y3̭RκeDU1*cu_9|9mRz!4#y*Փi3a["Y)}͔<;tUsk8_ k+ͱHTPb?տ2b2ȌUm}Vi/^h'<`xe  OS~ rIxS9u\}xTRq{jiwĞt+0/ѩrRWKqg \;L6d@7,{e͔}|$ijsC Єv@gCF rK)J,b RU}C3[ |[Mwc?~D)L k?$~%Ӭ,dzCo*k{^, Rr#AN8˼+7xFlE y1+?mmIx&bzgVYB ݸ&9K=g;c&1ty  ^jâ U;N/Awmh}`F,gK+8M*61acCI_h<9B};N<0V~$ѽQW NJ'o Z*HjPagUCEʴxʣZ ؁h'sv6~oqreF_P^z:xR Bis@rOPW[vBM3@T(ԙC뗮}&/@o1:%/Ŀ!S#H.sTM@\;%#[_[AJVWrzvV=86AeE=k@J̱8/`4z~AA:vk/2xN!qj݀|H埢Y '2\_^kXV1Ro#"ĐUG7$#&Ir)L?Y']\uf<݊L!ڻ坝JFYw/T8v̵E bx"L ` <~;ʛ|Nά͜$܆4 N2uzR Fa&Ec,=%)W=/w@yN~*=Uߘ&=a:/DP 1>q{DE7eC&]x(pMiZ0NUQSWۼC:յ߁M#3"̈(m{j &y9U_7-FBp 8NTЄ0+R(Y^"j} -)<{1F@A_SFoA7stSNy^dX&< YvvmSW@]Syb\V)AxJ 4~#i&\VGҎM63Vx&m^!@JF>ĝhݧLʺ!i.}^²]e׎ٝ}!6fLUSc]M~Fqh39=ݗ%ͩ_Eè0dVBXG Ґ7[yFs> !RY l*k2z)Fofw|3;{!ltO,V[yi&'y2OS@ճG$3)rG~Ev ĦS- ?4|k&ӓs(B3Vh00~PFw|>\s-ȓ0'wY ."uZvboG4R7 X xPByKߙ؁̾$'Yvw}}Zig*9{m_CzZYfw7(kKIyFs1^3\w5V2fHcxݳ~k_~pbU#lhAzm޴R *Fd; ~^I؂*-q hSXۣ8i :@CM}DZm2xĶ#RQ̴z 5[K_5pf. S048 kqQB^{vY0ӨRe/.+uv)dM&}"wϫ3ѽkVm܂>p܄`| TWr}q= !L15+m?DKLĪE7hN99ᴤnJ[]2N.]TC7L$zc<ȋg"-_}ʦ[kuh]WދII4e F Y_l,Z3" Յ/&;ݭkZ2lH WHVuOfq +lSbaW77ռG0oO#D7ed}$&aHR9?4zg7k gsHg}n>3PH͝ŅwԆB>!]o.YMģm]Fp퇬ڢW}F־u 6Z4/2MȮqoeiU,BX.w[:/[6P˦Ie)“-XE7ܣ&6ݮ{B07:Lz)2U:6Ȉk%Y`L۲E*6cd@%#ӭH>׻L>ٵo3|"Lj|=OٲtN^?Gb:]eF:psBѨ¡otC'oUC8s\[EH|Mؑ~pl& ?V?<:l3ctj'Ub*6:ёEL ܠڨIHKX\zϣܩ 'ndeaRj+FC=CMjrr"25h``sI3L;w^C-ohWk~5hUs0 {w/DYZЬga yjqΏLX;kMZ\I~ +E1{k\GoNxb Z>g]~%1-Rs^j"2x2 w^Ŕ ^vZxabA=|ұSB#f.!N :ߡ@3i%3zkFK8 Ke҆U,تML^ڝ'nY 3+^0Xx(?h[PQfyCy{2Y6LO폰u2IGN#obՂscSwRӴ#FFvA x|N/IKC:ѯXJW'cC7o r 4,|2/[ypϰw${T7矖j@(ď㾫[È)U9:gh g]@یBX.$N, xSjZ ɍ֪c AךR.mX)VMidt,EChԁ8|tR?+Jnk0&,h2xsMpt?I_}ҳ'}Vsyn]?c[wƤ"FA8 4$sj"aca\K9U4t-zsЦHqY&m:{B޲[qu$5&.EKhΒL9G,!WJL'swoMò8{E+r<^ekCVgnإGHvzYm* #dOee+Q|C#bD%Q)ju >H%.ͨ Mr~m`v:yF%D$6K|1zR~/C$&5J8jU/./L.tK߲i:[f>pUљ 𣭴6]Ec'",٭UpȠق|lb!3& {7mY,4L3joN%w3:jRpV%"E|fU~̿E Nc}U!$.j8=}aܻɉHYS{]ȶ[C]c)_u{Gaq*p M槃{<*ㆫ7xMӫ[#A߾kyƺRYɽ2% -ųPg43vvVr7TنJWoד#˺5 N#olN^nB`^[qrnZŁII"$qyS.ʑ|zn3gejUtI}yxy2OAkR1XۗF~YyM|d7gn߿u8 q^U:9VqA Hd6;ƎmZǙz' \KQ 'VȈlX}5l 5:Nυ$58$F9Dǜ|#=w~%h?MDqAc =srL#n~.mQ}_jfw䆐SL6%n2$My=t]X*5FSGAC ,z 5:~TW_NAv?6jTc =v.1'i܌Jvv; ⸌M Gl&TkFąr(ܙn$Qa8' f7nmN{魶|Y}6ϿYϙ6^sQB''> j8>>ŵX"H˳\#֊}Y;CjACсXHS'8PH\Z.~T@JwWQC~;4mm+(ѳUrUw|{-҉+qk߆8)=Nf-,AC =גDZ,س G^/܉1🴣X7h$wx.o:lJ!{alσ,'KusSÇ!)s:I:## e2A0{M=N綍BCh5f.f:tff֪荙zkw;e6p>-A MJ砹%Oa*q4H"`p0d o/rX5,XqD:Iن$s Ji;jĊuU/V{x"( 5h)껥HG7feD߱϶M~24C!:R$.u!J!!Q(u);J=Ǯm̸IΘ ;>%@~Î O{ܪ *-T:|Eu@EPб7 4S3K7ψCMbOH o `A0F+⋲irjPv贓Ɋ9CmZPWkm^:퓷-\X 49dl?4352| 'A_H1䷤XU]T%{DkrSmXg^u^ـ/>{\{jvHSC5FvOP\P;y>O K=u&~>S8@&4ц>t8=&2?76tZ-tg|?'r]Bψᗋ0%! lF?5nS7=m9Vw ̲&Dstu.}O(e*"ǁV2=eu"-LP\>=|Y8:shQ7$woA޸b=܉'=?t)u֏:bڗ9&aP%2Gx+)P@%`f`u NWʂEk^ ѓ>M 1-+^ 7236- DDBL[CHժx;1XcАDggh*IN?~!5/8ŏ7tI`v93DMM 0ͅRΡmZlcWuN՗ʒziꁲĎL6D'6f}W:| 0?N9!W A{{qp&0iK] 9WO6Qz-ׇt\: i-N ת4G7N8Cmq[^{^ǮO2W iWt)6YM)x_TOo~]gir:gX 9~ F15kǚ 06&&p ? 0v ]`:Ӣ1z c!Ա-*\l<67^B#S)KmYlrodvy?Pӱ֘<%iz_J(dO|o+4]Na0Բ FbEUN%u0}\RQliyS~iJtԏ<#1|>MM8e.;Vl'*vZJZ-2= NV]ogO"~Kzyg YX]=N[Ƃh3v ݞm[R￨FHx,DDr1VI+M҅ԿP\і=͊M WNjea[zkYE/aˆʞ;G攍Ro;QZǨ ũOt, @Jj4.*%]u ٚW2lMӜ6\'U-0)I W A8MQ|0܋lPSbxG_ț`l?d|l*oeY4BqSO6l|V4 PrU{4n"}=2gs3 Pܥws!J'<7 ڵ4_DߧV(Ro_qS5u L; 1yd9c%j|]39PJu%2.?GY!1`iA(w^gNX@}I(&-|>Hݯuu)$tcLÑ<Q65rM D};ggPw irw8g+'65"y+tY$:'uBKWF#ϛwa)VmV܀R}xyQ CFWٶ:o2\5 ʋڤ}~>2#.S^4uq*K$ *\E%i_+ą̭<#DZNU rvj1ĺF /הtAm)Z71/s@|X:"w4c˱yŵd{s|F4]1iƃ_Dw]Yb y2U0-d, &/@kJۼWZ< ml0!"{jjo ʲ̻qR[ܕ@G{*I->?<adtMSkwdơ԰" g,`с+LSQO[B|q2u Q54P*=+VK"UϿr[dv^-҇-0OMuA5_ڨlQ!wtS-jsJ-dr |D7Sa $pX46uaa)Ũh@:pˇI-xFpd\OE̸z6bf Nu k1W" >~DJܬ&"%[ r z>(auVPMf;iGfOx)YQLϊv'wwT% R5;M (Akx?2WʄȕK%`( ;źTV킐 oBK xK5I*~82E_6Sr6p瓁So>)*7G CJٞ%^zAg݉k!8p6v G:.}荿kKeG9DύkBL[i7;ҷA4ذFh3ݗs,^ -N52ީg>uB+DRVPCkI֊j2l#yL pV+ rg!a.1ZIgٸ}O 'n82++}]L2 3"I҂9~ $nZ)ϛ`ڋqXw5Lajgκ.q]f 6ɞ@#eD;ĕFs8ħSD>+*} zH_"w2^du700Ƕ =wD][Y}"ʣa's8@64 44ҞuooJg*]^f UTԽٵȱQy9d 6Sٿ[rS!1jrٚ"д]=Bq?PTY5,^M呈b[łZOjY oJ,ƓbCӚ`EYu07!e` ,{c&8o3(yE>UV>2O Υ3>oj:;2^,+ (8 6F] !?,*NG{2ZeC)HIȐ 9T\\%”%MHȕŰ_mO3=N/x-?_i?0U`q*gwt^[J7[\f8ZbBثEVsRW^`dPw}/E yb`f =w,z6?2\`7-ơtnzL2{M`iq78r{-/%/iE ŽB J=deN]Y_ #z lp7v$ʆ&]/J 'v.ߙ̭gMGƕ8V >)n9Vɂ!-R/'i8̚ݙ#i喛gk[wyIqb󷥶.Trq๰qH+~%/hۉo 6m+~I z:E}ېoL|U+FH &.fm-đń.H&%qPynТ;Wױ["(˄ F& 7L;zc=ӝOB`R9FrJá7XؙdkaN-aɋ{[;KH?~ڄܚk$֘aS3xJ p{X]BgSvA5K ?T5aF"o^.:*BAs};9C! c"P/nԨ4g zCo69WZ<YkːsW"EAnI7 26(fk@Q϶a!/ '\{r(4k CqPIaM4Otb}Mʙjec xN*9Gx|l`Z׼yIc },c{vI=M ӘВCf-\]%l{lBܣ{xꑠEK^r&={FmwQIKY^FW%eow4/aوp47pVQ>D I5(N%K|jܴN u35Mq_1+&) U#,Ei[[Xl_Yn}NmG*{"OHXCʓ~8r%@,}TbqNo*JC.r')f 1mCL 4:l /uYU ƃ" Xe%*S5t2.ŤZ[n t/{f+p;; 秹CkOdƀ24&,KY^~(LsM}e+EƎoLH=&9zoKn^Mp[[9my7U%g2|YH!1gxFhq]-⭚ iwiu+ZkucIpJ :,> 壯"EJחb6BBSF#+w$8a%xDyTsw-mr;;/eKh^"cUC*])ȥa}% [jP[r $Wyø .4& eoǗњV~75i{-.*F"?vtBƵJqAyitd`py"?#x-`RYl-s;0Qf,\ sNN'Ht6SCsm wmdrwºaWgEwqe8Q՘5Eڄ%5f6d?6!9ڕo722iƿ]̷"׷b/Lُ%>0m3MG |0{A )GM$i-g;IV Z@Ҹg[?Mm1W$D> TwW;MXr&QL|Ũ* T[2|]7 T WSg?ku+Wݻyb/uB0Ir1ˈ93 ?g'߲;UT˝ ds9nFKntRxsN<HR8HFj FHHDbR>Hݯ mP/cHFn1Id NO)ȡ_q:&f{5-/nYKZ2udI$p/21+i7r]!!Wap TL]#@Q%i ctM4-/4/1LWy //=^^VX,B?"iћj[fhRG< W%Ep@ᱰ{ļl/g8lJsw`ί_rYb Md.Ϳ Bh0>l5>,F6'dSXUQn8f#ΤJ^"#:KW96ML kH,>ᯢ9nZIԁ&#*֤'Hzx–Ђ}), }8gڞɀq%Wۚ渪 Xw8؄5gUD"3Nas0YM!G=rxv݂;sZ.yPf#ebXdY%-ClX.<؄KꂺT:U JLU8؜(ftoT|R%u1OS{Kw˅0%B[ENoxBs0TCyϘ s ([NQ$i"K0(nn %@DrW &=HAm3PD YBH&n n[ H(ʮ/YbM;ݍĻl0@j`[(KLBHëTsE~`x rA}򧊍KE˝e'דw/Ut~u=l qQ߷xYbZYʧS>yT'= q>6)ly7Y6 xR! j/u5#B,BD@g- }-Eԉa eu {-ç߯d*,%gQјr 35# 9p Z| 8RnO4f ;K!&F/9 NoyZ8as8{|PM78+(#HXqt_S]^U`E ۛfE0<HA]5x߅g)/E.U"c tklҕSj!ƽ<ՄkdͿ4tktiHD.i x@ɏb?;0+^#h%;{G/ϟ7YmGH Dd^7(&y5io[zsK42ҡ3tc_=CIKAxp|29q*-d&h)9wJwʇ~z]Ӷf:FKmm(} ߊ4R *]UM>iRl:m.ɦe]eDv!!nyhLbcd&vΞ5ɺ!woJSƊҚvsfԠ4:NzhYNn#s):B}Tg/hA~JNbyp,|\s+[ͽ(-Xln w*&ҒTYO!E-mWf$kPB|^'I+f@hx1 S34& cx\ƃWE4.:8HDhqMFQC:yc,x9->o{QVwF^iU` X`?N=1~/b.nlaC &(rrqLO΄ˊ6ܵ <3}BOƄcLJ 㐵fI3A_VEj#j7 g_e[vгA L_.oH` )I0G.Hq/Gb%7w l v[O}GDoHDabKndnj41/&D8UN7`GF&ۘ@#{6%] w.{[؀Rt 19ΚX}W>L45B bdTO(>l\4:n7bH2y`1w9  N4>%W(>}{q2eKb{My1( ?pZ@8O;\Dhi?it\T #y:uxfHEr| bj=ͨp c\y[>GW}4+i-$". vwSGA"Wo*>9Bȯ6X~Qw&BJ_Sɪ1FO$2vu{㰃ܑXrgX_S}"&/P&? B4L =V078c'q.m@KYt]c@ڡT%X7]{8X#ct3{0ֳuIY&7OWMRKOAdb,-IC?7 OI~!+xDFRFwi89i[/'rr1ֳƲ|&D{yih%v:c!QA'Uҹ٬vZ̔$t[ƱŞ{y$kƺ+Y$* lE9p5wzR@%QYTF?(o[#Eֻq뱄*<q=s%Ծ}$Q12&ehm* ۀ<y#O*H 5#\SLIO)6l @ȖC&ժv-JgK~%ִ5%e*K@G`d5>Y-bNA4bKPA/J}s}ͫ)wу@!(xm>hBdEB^TMvYDfmvBUf_HS8u ֧"U޵ Ij:,28UsgHC !{؃a{ _~A5]-YJI]Kޕzhl.o*"eq2(H Ё:9h]ޔ%GA4A\*5J0.HFt1}njpQ4#T9_]S%9|^G{|Ad5&-Ekup]MQ{LPGN:`iJأ&urŎQ\Ƭ=qe/hl v­53z5pip8N.}w괪$CA9eR_F"0`F_[!|-r ի1XD]FxoiZJiDlҀ};ՙfc9S0$yq6u+L6j]LhA2D%Ny7vi?'.Z/loV"6̅@?j8U]?`Z98$DXHcIDU-!jlqto9r~|$2\W55yXz 0eᲫݳ\=!"(=v&6?Q4 s@dwE5$]x,JDM4=:%J`8+#k]SڞMi~H9FA86dԙF)2aph;QV'61й T[#?ka,AMgq9Ik(Jv1dRzxq P gyUJt,J9΂g斯`vw'NAD+-AR8v^>N#oTKOlSly]YeZv-٠rͩ` {Hd6"q\{H.N'}EWp _zz~/72ooDIhUv`<&XnKݵpB.rJ=qt|1M-|A(>'БI% FZ#^VG)4 8V L ݝ̅I"^gTm/[q$Ve HDRȩ1&S,a` ElKY~tdRHJuF"Vu-yα'L$>(H &5_ukMx=."5.hrW8^dëmSb3hяBM0E(Y)c0߼^՘`J1r{~NorFI`BFk yY׏$Fp=C=^55kJPK!P𗷠Ʈ|@z`8qP'AYQ~gl;:r:"e@ΪqU#a Et3FjEë}m=KdR \9rtYr`_IIz8T&Ks3Rj1&vpblDzQȟb >ٕ  w:_!'$yY*iG ޣPD#q_Vkd+~X# OA!`\6ZA(:da ju ]K,PCκ妑jfVuƯ=p-TpS5U/P)8!BlT06Vy͵_`-eR}E h<5 /T&CR*ʠ WP#_b*QВ/L;UR s h&ࣂz?d mgGjZ%3_}ˀx.R .ZA9*h:1`&ii.t1 ] $L1ph:{6ᎊA'5'T[åBL^7;/Vk,3s:3IVoO^0 ilkRs>K_a 1:Љ\}ZS2ٞFj\A'BQDD›}Iie{͢AdMs0d@@G FP5p`'SblY(*Î__170ֈ QC kٞ<~s1r%}s#"6.[+qx[D\QJ|ll|=.E2TY#ozG4X pgP8? cgm4 KW̑`S<|\UUlA(  2.ꄡbAmRAXog<,[j&=3X.߂tM@~&ݩ)Ue%&,q&Tv|rjn%W|g1/#oc.hg6- 4>r 0rNh마 ^Jr<99g Yܟ,M0M@9 ?P4-Fʻ2+>"Ũˋh|oY]'r8NTޗH~f8Il(yXOӝ. L8$X S%w!J,6hT1s'Kښ $߻`)i{,\ȒKF@Lj:k?>~#h9F:#rs&y4mB$TDӁ=(Զv=M=H s5@,-Nix11F#0J ٮ,1xӊA>׏|#8>pjNusetUw=)8syYyAK%b4T_XFIf-;=۱XvgLas6I u)fTEz<nXZA+eSS7SοDYFK$bo? euEƅ>5r7f7s@aJxehfmBvP%7˙6QJ)T x0-&gsGxMG^t'.w9Dqg=À]eŌu).2A4Q>և/c4vDqo 8-%af bfVKX{KŞi-p 1V0]*F'r, Qk xpu47!ʣ2ˀ]lf:[B']JGy|E|hE w_(-"˰ ׭YqeF}@+֜ =bG/)b{TK*ۦj|io0Z+!{\s%^^lsCVd]܎0yX&[8KC${+\k/r:|s̅:]T5ikjK4@k{ ~O3'>Xy7)rc2GT ]xOq8[%-}cDziJi4zەR&l0=|{wapז-}ī?_0 -a |+͢Cd[棎+~:vO+S VAMiČI^t p/Y<`{/keK񀤤ȲwϗyO!3 E?mB>2 gk뒺XIQB!&'y1M |bft%!HOae"+=u,D?)Y{a3hf*@°-N*`;0S`9FV%<˒gC9"M{()W=ь،jXTy׾_Y^܉$cH"x> $9l`|:`0tm FEx]ڮ(6I S9[X-$-Ub2#}$އ$[ mƄLq|`aH[K6+A”{cfP[خCu0rQ7J]1j^]+,7+pOױW) :ǯIN:@V/vMTk,Q jjMh\,ɅD u7{L&x뀼ǚ#6$%. l&wG06U+8Qĉc7A0FSڭ5DE<lU{Cdt-$!kYOEQՕxWW|'Uk .nPCSYɱV(<,sV/6X* Vu6؄L 1orfSe;̿KbrT=R+~q@: 䫾 $zlPB<*Z6M`F}/ 84fYe~ڥP2q;w Uhu/&۲Rђpr͗Ōv=1Dī eڧ s+ I0 B½vi2¥ʿb~ #M EL Be,-`bGV8kс^׈fop5B:d8G6w MVt|E~/+aE2铚ˏ$?YWzP /ȗOM)M{; vkUN:6PE\Ƃ48PiHcҭG[u PУ<(Qeؽ9C2;nK]f<g> A- F iwp! @sZH/ΑXyr8K &6÷FfΟJe0#ٰرm6ϋ r/:Am݉i($\F'vIlAbF:;H%9&;*SĎGErk PWMqSs͸&4jƟ)!d|Z=K2zu1a5Oxg(hOk5f-#^Ĥ|DϖRxr'r_2 Pnp6^=|{zSL;c7@b+)0OGFqft1%iʅn-K0/QTCIe~2C暣uS {:Qd*=0ooJknl֕}Y4xֆC!{Sf#Udg!6PUfM3* QXdPu=BՒAڡ߰~}~ 7ܤ~Uԟ堬rך[U~9UO-IIcU |=)8-ܵլ6幈Ѳ%6Y%~IH+ʘǑ% wS0Ch+q]83~E` ة^W obj^V@5.ˎO9"ZN#rjdk;{[0 ow'LgBSǒ?7V%0ωژ#_yC-]eK}[D:Q84Z(:Mgi| ĘAmלCScGugw+ ,>?wm[|^:s~]<0;DNUz|ox5˪ ZT}![D( /@-$%FC5` Ϋ2]!2ZH ُ@ 2QÎe킒gvqTة4c2%|Q%<Ԉ\bj/&Zv^zW tO$Œe M:&alOHLtoQ2K/&JAjPm/rr83Sp0إxۨTJ+(Au"j:ɻlvr]E{лg sXIFthj2)Cd2WcFH8l->Ea>Tf>b i7\a;34Oޒef2mA{G/xC7A(bYj+_ϴ:jioOr_-ִZ]YUn=GVSj8 MGXP/ȴ^H~!_ KW_X2݈+I\8OEZa,LT.,U)~mMn1f,+3 0dJPQŨ/1ށ9A" ע:_4m0N+^")'-ins!'RZŀ/Wֽ}4_OGXg1 9? rovLNMN)rD3f?[e8FQWtwCjYOoosޚ~p~vS ؼp/ ^SS*V+wl;A4I""*#65XA'HpM[O F43q|!?A1];(0`oR wDw(r^GAۙqgt.g[goRy&!99B*\J<7<[Yb+,H7e橳r>">d*r`gH!e J wG ?;t-KۉVG`{ o4Sx$E+Cf9Yɭ5X/T>m8'WWh#0-{*Uȝ%HF~Q@Hak vr=kDDHZ!}ȥ ZgLHc0أX=MУ4_7c XG~6N=v؇^ oߗ<ד k su՚B|&{S)F:!W*M];QaE`?M|0p,Ʀ'#ԅI5HX@^7oăeߏAQAfmtQqnYWSi &;=K!aR?2i{gڧ_;n]M-[ps.(H2?6xX+n$V99jfZs5o6!c0]EF[ݮ3 }HܤghzV_q kvXmb/953ųqߜQw!0L^`e10D f[xJ00r:^qJfYUOm uxW%zkù\=;CIؒ-3? y,ss8z)1F3N^ڲr*Zg\یfuLv͕졂# 88\z=%,.pY@MmKU&%k(1ᧄ^_vۤ*چ4^ ev%fC2}=ج(5awUZ? e`׀d,,` D%?WMvrRK<=[=Se7iubYj7ݎbw\17F/5+cʊPOg!"|ה-umdQ@GL/: X#&-LfܪhFZI~,(NG--E3uC2OjtDFgru k$q佁jC;ԇRakm^SjB\dv e¡ b¹]]8v5ϾtSWQL&syL8Qegk`t>?B7,4"Ձ?!fR+~(@!V*(B]hm)/O и-ӚwKQq"8B\~@jȘ_49ՂKŁϪAP.mBXam IM>@j x"YBTxz kY +AN*v ai[4`:5\ޫ~ VhO~͔i,QbLQA}Lal9 cK;@ȿjLy0~0sm_A *=xkcLy@59RY, 4fD"4V<X|h<UZrGZ^P-ӆ`N ZJ\|zͶ_i Pi.)葝*}@IqPrJJ8$m6;vjA8]HS3؎BxӪxFMiGŠvD_dHƟ=uCBĖcC"h^Z];M;"ň1d焞ښ4ZqGسQ8[ywELꕯGK @2WmumU{mFkLTBj} &PĿt[/ʘ $ٟgF :q=e 8"Y| k:~;̢{`^Y@e4 Oԃjmr'h |$Gz, ,H$:<5BJ6ukyʓ߃Q P7P+ݨ 2?<;Iܑp\pRޮ{x|~Y7~5G.2Y{_dҞ&$Xp$:ߛ{@_ʟIħ`YĎ5.MdQgc'_^d#~T50'C6k3y[nh4,]*KpQĨ`7!̬!djEZ[B<!̇ lxe4FZ- /ggT; r׆oPҕ$E0H ~]HRYA/ b0/]/dנnuM1 mT $5gm;m4*MoՊ | ]v"^m S9>w};_hSs_g<&RI7c$dMȶcxΎR$&bX ']};) ; ^g_mK#mk*/A$YT?E?3oˆ>!{3,%T+°"ڡJT|0&\n&^/G P6O>|б6B<R|>a~MSx{*msLq2͉m|W-'@tAz Ry6Q(9y('tDW|`ĜLFW&۽!X`>-Gj8z;;J6^HZ*[4 EUO7A!\ ]~_ S/hp-⹸6 KK^yOI\=ZvGQ+~4P< X}K5N, әn33}s$fl5 #Aq&U)} v9wf$T$*Vw8D<{,_晭Ixԅ-H4~Wbbo]]6}qZ1ru%';Q9'|`%{ ]XYG7eRK=z2BX$Wè4H_[rLx'1Ij~&[oЍeqS6ԵN4\v>&ࡠt8bgkG-~FA? پ$SqEN5w$hūvַ}RH1rI ^q/͌^T7 (z>W,^d/lrBYf!h2I Y돢j`ZlH].Z(O=8V- @έ+yrO,_qiƒK:!V6Θ3 fe )^1zHRƄ~]S-}BFcw[,9Y6SZsB0#y߷-DG%CjuPAƛmմ9W'(I>cTA_o*[WNꠌ,84)`$u+` ; p 7\Krf΍DgF5F-L c4~lKZc UG]40 s2szY\wBh;ֆ j!PYhnTP,U>Tc%M]U.o×E (nu12QSֱl&sz :!QR=pTzq|s*vRHC$~x㭈>b1g=zks/ ߧ:}LQ'{D_BØ'VT}j%F?3ȇM D.ZȔSEŠ {O ޱ_ɿiR.+g1QfːwG_Wa504vKc}Z*Thʙ3ѓ0'0%HS2Hv7gD^8Ž3)[g):pac 4֩mF[YC̆\980CIi:?/.giHeEʂMT$~>##HVgE&c"u0YTGtm5~f׊tj'We(]v6)B(Wy$m}(]yҶ/ax(rWȑ9YQn)= ŻM&哪Cc-޺ W'" UgK/a/#MpsHgϱL3 0[diL8X<^7&svct5 Hˁa .cpR FCsCy!'u-pkC=E<_i3%* [ɞt׍:kah[Ϋ1f\5jTwD~*JvV 2ww錻M\B A]ͧE58eR(J]"^EO N^W)RPkm$Ҷ(d⃕&ڜHV3=%`W# R&-;gARV {1\UMUJZ5.n cn Z@ӕ4 h U'zp?#Uɹx-lLQG'P~W쿉$:kC~ϰks4i;.Tw)}J p&:> f E}hȒ.PGYKC35gEIrUu#Gh[BXL<_*)!'tFtQr|7kR*u6l}*SQşiE˙d"pQ[U;;n"\Lf^߰g< pD(;ݾ,0R{uk=5XvNR}Q'M#(}|w*LP1L{P{~&B>iG*<-B+|!~ah)Y}tVQIp^a?mmͧm=[Ǭd[85MaRCiOE@ EhQ%M x?05p [`6Y[ doI2zS3ES5(c4T_\E؉0uђ:/py 즈aQq͗mʞtЂ֒03I K"m, s6&hm!T/TC)c>Zv^.j n$K#/˗g=a`0|ɛ׸Dӡ DКN*}R4B!_ݢSxnB >NJJܠL81 NHV%H;Oú W_P:cRoRd.v@-<$.+vq1X=sPPAR+Cڠ;?5$Rw5JDXfE?AQAe Ms4BFT˼10#61|~5օ y$k$ՙS_9ɝk_MAj0B?W IQ#DcGuNI1az %Ur6\?x:$*Q0?3g?T dz=ʢ,i.Ai0,<_hbYjҊC^WǏQz7dm*>n֩l^r_y_?sd%*'"b HQAek24٣&>kMyu{K~~mMg3uuӠs+MXa.Ѫ=IZ1Wr`R2&c\m̭q5%hQ%m+E cZjGlxL !0oߒy1iLn%Vb+ cs.֕0RrퟬvڦǞC?2mo;vL|Y?GIaQ.F2S&8L4YƔ`E}u?{f WRY{ "]|`ojs$N5hz2U[$1Lql5*Pt,NؖU c,Ɵ9@!"rw33ʺ0 SEI$ eHT{8EǢNvğzFZbMi]Q缚D4#bnAȘhW`+t^]fVR D-ϩs"U>w8a.=Rȇ Bن~0uOM*6zk[H芏wdEzm@cB{#spdbJiߕ{<+62C bRl:0yD" Vt31 ߰oxv/K,KK>SlWld(ZS dV0鬳`cjvH IwA麨Dy5HVSsY3զLukݩ0'ijH =2@2ki V8c؋+2gP&ʄ|{nS2=.{iX$cf+!Lz !bF˻XdSɼt zɦ>{DТO`p?'$,6m%6Q6?t5~a#BBsD+P9\}HyM9C؋sަpT(˹ |9gyɁ(D/J h}O xVn&Wp[ߑh-ٌ*oQ#P$ DrN$=sw]wM.J0,zBK ϒ*Ԇ<P{D?{`F*O:hP'(w2!Bx&xמ0NMe?5P{$^ 1H5^_ BaIׁ,9Δ3bd]Li ANͽI/6%fo61+ ĥԡ2Y:<{::aA>I(;t9SIFL.*a @r-::~-ݥIEuX(dRxm)G+H(#Vu:ÌM* 3_Y>`i`!B̲̩K1s*C l|.:' pz? ޺;ZS µ]MOX\tZ~E;X;P7(a&>`+!{E jvGuBSE}k-|-2fHN=eUY{4p]vObtI0y&:.Na គțnKҥ0pvᑴ62BIm-J4jϛLT%TS7>mz7Cz7B1YKdJds.&WoKmyF+G$E|0-ܙ؄ dsmdmM;% ٶjv5SJb(3<y$a_`,M~ yi7aH2'_vpkTTHP2_It`xQ:RNv₋qvklG3p\8 >"+?"嶡&4dS$YErp#/DBrV oibN1۷mیOElip?^e)_*AA` H',f+v NA_frۑᬟG*!Ω#J7qA:DHe(~HG9UBԟ\UtCtWIa˰kkebԾD$oaHpĀ9@ѪL[6ؖlpUa^dUW0j'E83gRҩdﰒ89N`vD 0c;uo=e;1MLEhu2Vj\$hq$W׸O`Zad_`n7Stޖ TפA$UD<#fcJ7Ik-@珦S*㫓2HzrYp=]27b sU6qYJ9jwn".kdMNK>Dz_[6ag \ 5>c}'"RJ*iV`}ܬfի 5pE oJ$rm]`I$>{+7xQEGl,TCq+\wTALwgr iݽ<ޣ-p csE3ǵld6DQESe*m%7s?nޞ.u(9JWg%-@c˿u9ڭf^`NًY ]yD=&L^)!fh7& xH:Y5|NzoK HhNQ/_gje刷kspw:iR C5aMC_'e,:|y[1po/ 2*2t_'xWL[)<$+l8J#:@̣u΅2{Y*9\= d5{FEOUSnLUG4ب򟳫Eφ,0䗽GYoX#Sݏ-:'g9xVPR?<#ʝ@LKI8>ONZ}XP2֥tĊ'91Z-j/C/vlJ̐#7gȎ{5u918*}S䀹h5xD-_txsŐJM,k^8pjXTbKB$nHEO?2*V;+EkcVCiٮ,I 6 9&!!9 iYD ϞUHj>2[i.kl1CE3>'*4bV'x 0yү@߹QN[Ԟ/2WAjx5 %E:k{ӳEL zx+K(4K\ɫ955AY!/MzM,m|hWtcB1 PhuF?kw#t9d*m}6":;OuN;.tBXQ B0>QJHLmVU%qU[p/ytKrhp!@Pk@ʹfA@?I8x?!;&+֋4ucPpcnH7V l.ܵoR:dZ -_Qk3e4ki|ybwEXɷl2XI7eZ&9c#;HJwoݖMUkp՟i9=Wt'*r 3FNZWg$4u1UoRdA`+о1T-AJ ,A>V5o"hv0"Dj<)>ѭ0+N>rҕ.>源fd/̺ܽT`dP_gj|闠z6JD)zwھ6:Ŧ 32OДN;y]ի'hdBCvOFћj?HJ~fv$lzS*sZ?G%SV', sl }Y|j5 syIQT0ᶌqL~#)qu6,u@"4 &-G3^3d퇹j#T8V`J/w26&634ض3iiԥбۯ@Og}ao Nr*RǠh}қJ*B[޷-:k:ŐonZL"lxkh0!G춪 4y}_%-!  J'=R:l|u[*L FA< 8چAT5YaBeYғ)f mWE%-:xYM@RxFߐ̝ZU9jC _oLQog~8.㙥m+amdeg+VZB+k}z w}5]} jn6D3%PLDR>v)B)TT=pk G0k -nPTJU]:< FVۤ q1$fm3`gi%kYdL)tAQ6`;H MGf~p; JpvWT`]Ic9[:G;m_:"Hw=;y㮊S?gM:|4/ ވZ͸_ G\a77%8z-G1\7HFgB.`ך1bFqRQչJ.-К|Ni{*IG'ʇYȎ<ҨY }+}{9PAroB&3")E Y SP"HE3Sh{س6if%1ana8QwH4ц=oy*)*$^~ ?+?׿ */S>z#;%lӡ"A[h=Ed]@uzdExo 7ڂKgLJ"ͽ^IR=bt (PV2-'ayU&^/i\m;zԡ  %#ċ% )ς?0&Ĺ],!{3fbK$N5)>wRpZNšg/h@bO`Q0^΄훭 rg[qh>U:w -U& ~Zݐ.0*g Ͳ6ǔ7A#CL}L&#MkW2n}Jr} $RǏy[p5$N#Z3=Yd%&(7-SiF'A.l3$<hTc{y0S].j6Ϧx[?&ռ̺lJ)!m[gW Px\E.ˍT`a_w7޷t=&\kc|KLx OH;+ÑTB0!WLiQA.X'e$tk*^_`yBةcjTn 0||; 8;?{3*x]Nqғ ׿bks^(UF&H0ˬ=ZX>c$9gHQ^jWW/WCOoY]Ĥq w(mYeB#2ÃRFJ2!Ydg%I"*hbC&VYWDLt-c{%%lo"%٬K5Y-$+uOǿ0*ZeW.%AtWlqR=0Iۓ!ʈ5B* 7|cP-umv$:a/>UXԋv)]w_s!m<* g@R7/& }~O3eַJtHmy\ /4 E3h/gF/R[ I4U ;Y閨*@ETL,kʹ.Tm,6 ۴ʇlZwt.7tK9v(k޸CP ѿ@Mu1ɊC$+h/9b9F6/Ӣ—˜G509߬ĉbopuu]=]\U-Vx͑s(M&Y%0DιZZv: {,wQO.R7ʅɮw&,9ԏMntmqPPn:8n <,%t`t]Zv sr -S |Ȥsগ1ߵ "d{)C}}}pY].@KBΉ +sԢ_[Z @g䚪(~ Ja=U>\֌{i]LQ-NfƸdtJp޺}ˆjϊTvBd2م;=m3W5hIIlC6x">l)cw&pQt-6FAᎲV_*K¸qk<4:[k|X|ҟ" bI"C 7bgW盜HLtKq{=T9LXU8PǞ9sbXl/- \?PhC#0!3 1 cqߎdadϬu~ZBtF^k$?H"F"9 8<|j؂4ap8:I%;Xm:U ©Ȇ@9ұ+~/gM7@n͘}H؃Ǜ +{*+x{ їB2&fn:Q2߹L4͇7-CxM}"e4)ZyTD`r -lAVp"+-**Tq\.Y"oY{`!qutjw^jFf4.Ji轥\tr[)ֲCńJCbWj?-TiG+35\i~u#(DZQ0L;MND9`̞,1d (=i hMl}8SqggۏO eͻ;Fm-R#k#IL&"-`T23 wg9L<{>TS|#6 ?Kf-TEw)BqQWW\|Z*{EwMc7~ɯb"Ta=fMv>=:Uv5㏋zS(!ܔ+1jTJ^*M'm(0k C$h„* VOv00m(Ee#^a-EXvse 4rveuɘMO 0ΊvGLKT:GP.Ѱ}e7Ռya>| ypsbQ`nt]a]B!!2,YcVO)v]YWn.ҥ 2nR(kM.+VƄ"YÀu&$2BQZŨsUcDHK$s*6Ni@b=[6gN+S󀔥=|fYZKZ?j$M;Sl3Kn_x2`uqsx})"aGq 2śIQASev)sՖ'T_y+]-= [8.\Q3(>옉jYNԠOJ n#ezâ)E"wl9 iȖ}/{̨f[8F*bYc"ی5UjfS0~[i ė8?Yf)yM,B>ϥ*3 %6[У}*]"j}2(a:'@;]S[֭T M`6 "^B`T} ȹuF N2^1\s$z肒 +u57'V1Foǝg 2V@vѺRI3Xt˓%c%irc81HH$wn:&iG GҼqOG7)Oi#ʹ:Ok!7wXNǤ$QlK}ut|IDIZ=4w_>~Ĝǁ]!LrCvW }oPlQ8;AhP5S\V6" }ˊ܏FB[W Řn7M ;iPrHlVd$pc {?]K!*'y7)ivn,n-(Lge}dj.ޖ9ZZ0/Mdg@:O<:M:88E{EI.(8.L 󣸄m+8A{ซ>RC6oww B䡧7#h֖ǏY`J]P|f.yc]: y[>`Ox0Ka!'7I Br 2Z\"s #2PW,+ņkҗ*̑S@9(u9׏ZaK_RH e K6.9_}xh4|Xsдt]kℐz{mnk#<;ij]Xxa񮔈Z8ֆXuXј|([/I \,&D* b4ySb:paƺ -H_mEÜh*L r3hCY:FU@NgK~JDÑ 00KFTO}ܠ39#o/4TA⹨| 9Zqe+Q2pKr=0T}~rm7z9*x&V_Tْ*R~ |0 i=7N]mǁMˑ 5(']*ې @I~3iaoܬ<)܎P67f{s,s-Wd瀩 OCCUP>jlw ܠt~~dQj ?q~Y<4V&ӕ#Ts::%N0CG7t+c7L 0&'_os=NJQ>@%Γ ܘ@gY6. 7en3Qg=Ña= 7RVմ6`}KGeai+~6JEFAcmw.q)4^8,[ 9Z=~QÏ{ښp j8?6$Hˮ}sfx}7sleN }\A"#<Ծ=V#/ʐ?{ڴuUGYY)wi p' 6P/a2~4FM2H(LL远gO[$zN)M$OAdsЭj\lFvI/g1"*D^ eǸi+>t ,ɾ yf UK;9b-.GGcEk >rx"&HlPquẘḀDÙ|x>_Æp1᤽Ob]f ɠ/=~c]6(P]T^ RJS,@786:mE |K7߇NV J8r[% NXDN: #Qݚ1Iz=կ v*{ wGv}6Ev)隤p&, ~ʥ̙Ԃp5&Ǻ6. /4̼;=HQҘ(SP&3V,'sx !,lUV0yKcRj.?v!,ՀDIzĚ%@!F) ь}6'* +9F.y.~,̽" W`#~swu4É\kk(9G<$-۩~'Io ^]W~Uz`ϕ6йlUǚV^)E/mAŀi[zF$=W;63 q~eL˲& N{E^@?xF2cџDmRUPˢRY|Nu%yxzŲJ 0>N}u{Y@5o[ĴUjĶ,6鐧kl'VF(\e~To@y!P y) ]+&!Ftbo(p q5rR'1ix-{#'أX^/XW=$`ui 2(3Sqk|F.&bxLMNYK^vWP`nua-Ԏ[6`@jN tخtևgF*7sK &]T.d95o.s4s(Arl>(mӾa< f;̍jyxFӛA==#/~Nmrc>7{1$bI=5ׁ=}L)4Mr}9s8>(IDž:WޢI49UIĂ֨~꩙88[gpZn1P|K(gY`BL1PP_s~' ::K9RNI5ԫ~C6-\م6 pBc ѮHyoPN,i/}w^Maj ")=5 Ą^=,T6nj2XjǧYqS5(sECRu j# *6*N)DR 25Am/[n%*Ĭ \. [Q*+1Za.Nj:+ۅw 1>L{*%Bz8sw^cϝZ׵ '3$Z,;٭j#Eѳ$AXn$Y{r̟Rx4TjutI.Wk? M:ۨQ+ƍX$ኚ Ө3=؃ZA!,8}zc\EB#;67:H/:iC(E*{M/Ȗ0p><%s:GW"d[/gnmujY4>uVqYuuTmcgSCgi^;`l&sBg0 |*BpaHwy̠o)GG^c ,^;Z/otvzH&tnĭ!?'f,TCRl'J,;MR.m[fxΟ֏V:mʑN-n=jEH.rq!KwMtNecUˠ×O 41 mUMI|ɢҪ**\̡sbzܡD穲Z5EӟĸmXyYW>f/x'|$AJ=y]i`״KSxk=sQ=R4TZEجjתl4 f /F #T_Y;bQ) &:9x[D %Zy(qx@vx3h|^6b\zUx?ehM0G.xæ؇onTPO=LPxD'|1805ӏBF0<6`slْ9fDl^uN A٨C~`Hl }7$(QNHB&u>x.e{AyiגzZ"P0YpŐH<ܚJl$ 3 {]s=XDհ<_':j2غL|j/0>8  SIrOX%xs.xC$k8|=#D*U9\s_u#aZ51rw1IgN^OUs)"VFWw)$04Œ٪t;~Z*љ}-;!:`4Yxv]FM{f֯qWyZ1`_ lIbM8jBue#C9#VFKʦmqw Ha0/kJ CuP%ӕo3bS YMR1MR㓲u-D7?K1vԎ_ :䐟4y-Sgtu97. Ǟa u-Y=Bn :<El1~te] K\um |>yyJ`ph_a*o GhWj8@Z &?j"S# ^9;DBw㯅]Ag/?5ISs{{=YƪȒYdb}U48(/d7FG@9|XWcCa L&Q9'a|];X86hx10 "C43"gwT⬦(z ϩP;`1@e&azZU)ە/}j4ӞC^1_ =Yh6"ӊr!ñP<9s3:DFQT_{#RӔ-$wCI $/` so9h,"KJU/8(Q.z!p+y=a,s&Ln7CZ8BӜIZgOk<ҍEnLW\׿8#ASX37/R7 o$m6*mbڣdgEԾ<_5l4 }=gA ;3HNv7Zק>>G(p|+^VWH@=9I’ `z\dyK7bV['йد)yV5g֞~_0K]MG }Ӝ*?>k00EbBͼ1Q*\@{jH?dl]"|ZڱXKofqGV4߯"yP-]\61IwmͫB\>[X$, b'%j$r?;wF7ePvr[30&t< waC>X?,˩GtE.aRC1`e9Jc1jgpꅌFmSXXrfZ5CToӫ}>eH>+綜P2/=Ze,_%O^C+k [ֻa1Fr8C5?iRfbl5@,l֮rRܵ1ϤDUEdmfN} 1meV;g8]Mr-Ú.:;4*!b8D?P;e( 7/ApmOx`9t֏//#ĸML8~!)?.T2|]Fgu=UL,USz>(PGҦu3'NLp b֮bƘv Ǽ9{V--[P 5:Ib^e_\9݈L"$׍o Js3>R3VueeE\xLUj* 3C-ĝ@F2`P!>ЀǞ:"2)*3 d@so@`DM_mn)r7|j pyT #Dad=[-9e @p4GOHLL &^>T!F]jYsU;19> N h@>&ia3fq_ k)cAʇQ{-# jkZxRt7KrH$nf9 `wlqq) у}搬˯*zAp D\ ڗF;YE,VZI7^16j2}k9w_Xt(g4Ia&92*c(.-SG"V 1"RS?V{? mCyGD_WѼ,,m|5WNdS*Y3#*z}\D*$9d|; |Ł+b?fto-DHGclơ1܅w w ws]WzPDpA[*e62CTmP\˫:R0gHNm#Q="'O%U{e]Zğ|2lЇ5ku\kUI$q1 ..IK l{IfO~9^n؃ g}߭Aj/QH@:f~pJ'M/*XHJ0*V}ެ[x>5I$kyL}ȍ"wC)O̢FwzK2y.adኘ<sB|:Pۍj+ B3NS]'!\8bNE2%LDFj'EߌGTGbNۮ_e9̝픕ؠF8/m4֨S.* 2[8Eb 0HsLu`c3;9=F\?4>/KmzRmttV0Y V-8Arl7rge{R3ȷ,@5%ŪLAs5-&Jj*'5a c^VtmlB8#{J,cD't\Q)*WL:I1wo3)q$*VuŴKBU4t񲄁ʉu:'@FMRT8h[Q)5D )xIMGx (9spI\j~9i[ \tsdc|% z-b1z=yz7[* ta">26U"xPzx#!YjA$ha gH,ЏPĵ/u/a ^$gMIa)tfR5BuqcTrt'j;K6BR?/n撔q͚omb5؇K`[F32/mPWy l3V\ű,՚lJγpo3FGzly@crfWSVlHU2e  wxE.?x( DPu}v2]% ,zh|5Rj 3sVKS~{~Rح@3&pU9<XѶ2"^Ɣ1M _>Vwh*J7ƣYe[ravI*gϟX+m7w| _}OsxxXvWz6GtHw(xɿ7Noz[-* >e/ 5ECZ]x kndp_Lq8vsR#0~Uu9N\Rf%4ksBM>V"̙J~]?<}=Ygs5A.h ],>a3@xr2qf`KmߞW t:9hXa _+B60C4n"d~ZI4##ccjW}{J!5\DLGσinCeB`?w&3@8\lnYu 9ApE@~ #(|m*Xne2%U>gxx,e ]V'-Y.g+`IϛhǬ L,uS#v@Y{0-zHn<ѻ[Bqf9=Fʼn](xsvf۲$|9BG(zb7VE$G32J}ӊc|Yk*9(Cԝde-ޟe6s}(RN=ϴU_ >X'K{p,0drF| lKGf)m2m} 'M+3?ˌ.rj-ή,<NQ\\ \],,X;ۓ5Ź,1!2Z(VFR>PXy=d@] WFi!hcɇ0'gѝo8|1ktOM݌t<)qT5ďtCyfj/ ֠ !k,|Z B$A A`K0C_a̳NdPt!*l/Q72z/Uq lrDR(Y)?BZ |z&!U.GypF aZ89ʔf7k^@`tG<: qLjPá<5A'=.݄\ $?Wy3NJdr&3)thFJr"8Z$ī:Ysՠc\Fz=}mjstiAŶ)4w뒣gC|UBԝa#;N;#.G6$8ѽ P}RUwL 0dn:?G^c 7/I"^ga8?OihI~hyzt^ aZMY (k QqZ$3"};P-&(\䡟`#}[Ixi.ĕ)iLH#m?u ȘKZpaMK̍vahwCSEr}R!O$&s J- /A&<<398xQdq-.=mlh*NlCv:m a#":"_bB+^xbJ 6LxJr?e-EZlꍉ-5lJ ns#NpI(Ŋ3מVzr?9En*t!Z+ 5cG-i1/\V"1Zw6͖LC^a,XVy܉\uUE`C0%o[8t]n'2@ҨABxRznشSY]hWx^KWM-7gpoqG5~o|@(5_C_7pWEY,8 +aIHSzHϟyk]$ /o-JBxʼnjL# *cK?ӧsPt0X'4UˑU@9W Wq<;ou*f>Mfqۏ=QN4{Qu/tHTLWF _[5ʹ3^~f(1vh~@᷏ W1'Q/;'O`EAN b W<0A 1nI e>G-؎9K%5KHm''< gך7@C=d_Y%(e>]0>9w,oaa:[挜bRQzX>R nlJ!OzIBè5ͭel`vaIPR%o#CviURx$"z)w2Rgo179wǸ'cf+~ ޡt⛣1ȸ|<$#F<qY[c0kUO:Zһ$ 4d<@Bm( E-Ȍ\Qйg3tt-$r_vECFʸkzR /E1ЋXt˅OjBeh QD :i1XM1`8qܟ-^ fRUOLc=O 7@n,#ʤ>݀𓲨=bHDNARRD"^\bb蹝<$K#Z@sQl9%UyF V\s.LdbXۋ6F2PKО4ބiMcųؖo5&`]eIi|ʵHN^/ȠeJ[f>:Q݇yc.j]b\~Z^T$>9um_woۦg/~_NW2EYQ@HZu0"=ƶМ$ZbB2ɖk|?N\LLo'l/t\»HcV B+P+ iM;%cya镭<;?kؠw˟$/vC3 *h%m|1HZp#4'rLZ|wvFϒ~Ɔogh^7@v;BgTpA+K__4'<~x4$қyf_D Zկ> &MM#=%RYYjAӐ*\qQ+`*zet'.8(O,>)s R)kEEP$luu\= ÆhrFzήйxM K%#0#Jlk7(e(AI Tۉ=8*ek| jxU3.49I6 Ϭ~o Ȯl"ec,Xu zXuGGݶyg戃c'' BOXN\OjiÂ5/J'mjflqx'YєS wJ:\L2ֿF{# |ߢv--El ja90ꎧRKc eŋD.!,Y/1k;o!o_|blD-V.:84y0:ܹj@AkpzUu]VyP'I,&I&Vj+dxcS(Ro>Ff[cu1N 9gzFra`]՗::G fp% 6~6E(?hp/XW -j}2ڈjEPRXWixII SC5]rZzmtO~{8)>;73;&D -(Q%G6pcFOٴbmiئI>УaTTZyޥ\D "&SݑErUj2漸l1SK+X.GR/ul ClǻOEc/# pVĬߓBiNӈ SfQβf{nNT  |ﵬΉj+9b2]W<(B uƿ?rfX7o&ݬRd'%e$GЀq ts.rC. ,d#9.Kj8}V29d7^ʗDF#eozo YxI5ԞnsIO :E қX AT<+LJv$DWpYeI7FO6N>6y܁-Mj+,3+;Li[p=Yc- QfD=#D0X4=2u>O[ E3q{v'9= :ӣaQY()kv%IemeUXԃEuz%h(0WوYo9@?3Ηn!?n*(Ԝ_Su2iF}ZSό2ӀFHbz㧷!`Iz I~g_@^b$"n{AOvw;Ry@Bc56bEAc7she72<-Icr|vhh;٪"ð2Fx4)I*$p{->XxRSJk\_jT=r0ތ~ p_{lpVuOAd*[(~')QPݛ[ )9W옍w}{sdX9x|:q0z_ ͐!ѪQr0qg'9WvmR| '*Jӿ=T4/[c'־"1,A#)9쳩NU|bOyjǮRWy` r$/} 34HoZWbbsf@th)_ 渵잦,z=շ8/Q _8qjNd@-yט*Q[ =[ ĦT.븭ٶJUw7 OR6)(S7 .r݈޻p2/bcX}ٌCgw҈9c'3v6/{J 8N#^ ry\367K>+ߨf5V2"@ X\dm`^՗^|r>z_O x(z49->Qn;Pxx|chfe\mG8/: Tc{QH\{QnKݙXܧ /w'Y9Uhv/ S:blD9,<iInX#ɴAMW4NzoC<k` ]ӟElI[SYmXiIcp,[M#EY:Y>`&VyF&yDkkV͂ Ef@ xOyrdW{e#y2MBYz-d Y2`75O] tV &<ٙX{FH\`8ԖlE?8,-!/R9ڀ۠fjK48,ٮhME];ˉWox롯F`T=)aT- (U-Y!=-&\P%.0m0˚@3sp-"N^O߳>o-梡e Z L[pQ0/m ԵP)ׯN\ih&En6kA\¶PXDF$![[juNIn8#^ޫaY6 4TnzTx,;1pb*^⺭`֎rZpZe5f )!Nb>Wԧ:Yw0BCRi, )f!{ O3&CCŶy'Ԙ@vQ1昤j&"iv#1 "RFut)Stj),mz'Ֆ(ה]>mO#]TXTS_$ -*,3&T@=g!U?6q6JHIjmxA^Ͳ VgA mCčiZ%Fx fKޕt!6T֯9 <|1ϓYsk@-#%NrAK55/Msheuqu7jEXЦpڳ6Iƿ,T*Jxw}LJ+CQ˓NZa^Zrs92|a&F?)KiE9čcih!sU5$.`\_,l4[7M#cMnC3dyLP5\&}ٵ| ~T|G?QGS!9A`Y1#Re&ԇWLgWϐf$ES3x碆zUJ/(cbnp잗fb(!T(na jzMb'= a3E~R.WT[%j<0&#C/Tl]X GϴEX|1KH!x*$wQQGL5Wh &Svm >M@#P =IMGfJh]jU{ ̸O5gl탥HJyjM~c1Zp#DZ|r:K<5ڧTJU֪9 򫨟tƧPN@._ isy3UVx= +^ khZ5[Hoc~)R(\03 P,`B`!Y DS 0?3 w&ʓ6C/xCX]EQ vD^OnF.J۲I4C*JO>Tg6R`qk` ۴oel yfzl)Ss:ć1DsIMB([>Q1Nf()]\[g(ly'!*gŦψ5mܟ_[h0!.vXR=ao>A_WU78ϸa#/)328LrZjﾲԭq}i!+`GEp3ҥ1\8""=5q{w!-sA{m]KIL2u`rxomdm~rjVO$b;e'~8'y>ZJu*U\,)DY,48 )X/;!=:O{3amvDsa$,q%e5&4|!)ҍ)K%j/Fx[/VϏgsnHlE'7Y)o,xY݌٘;uBD() aNx{◉ 0;7hk*4Tc䎌Y?^˙ D%\7D%Őv󸟛9fx@,w ^p7 EW!pbfo/\"7֙41_'h˿TpB7ɬnl"*jbzwDr% vIАW/0n龹}4Ģ K]^p\B)胭mLCL{SY߈{Xʾ*~xcmlC;xsh"UXm:O8#J@kM/ZfNOP&gj4cȷZ1U85xj+Nav} .(y'`}4_bOBw - RRNwC./H@:c8t`„F|67Q>c)3:]/|*ʩ5/5+*NޒR]<2cyn60x  T՛ݏnS~ W'e!yhL_mXzd@Ah5P`v 8HFiI~vbnf͞c]MF1 ׵p e|ٺQ@.gE4,}1 Ea\J+  2J%'X}lRMzSzٚ% q TQ{tB3QrelB;N_%, fFtN AZأ?s2GEӸ,lArx 0x6Pƍf|j,lsWq_1R.{_ZV[ۼf*l F,"kΧyCm>h Eʓ3 q_Elsĭ[YqKvWmrṱ PJ {iwC7,$[HEWrn YT22`79vL~`C<].xRԁF@tR+Ѷ_v 1ZAO[+? Æl4e6fZAӺhHo[-/g+F"Z$_wk8<Td.鷷FԠ⍺o 8}M2*JW,y"hm3۬;uʦj0$V1:aQ$ \H.qH󽡄^X;t-ѣKH&xZg ]񄒇jDEa(J!Abyne/HV` c2~Fi˕+y˃{- +V1ı(C;}9&RQD̴Jve܀&c6mOL t)#:L񤘠*"#3600}?Un׆;EzջTkޑNMj[ @ksX育2|$D.\)J:RD 4ЕсHʽ=X_S̷B(qJ_,b>I ښecBGb|SI+PnQ:! C0CePu{(\C.q }7cKFgC@$2~yXűj行-͈)oo۵:O&Hx zG%$Hl@Zؼ`S~/z@}{y+k$,O໡} 2&2J#ylܣ~[RDm%ԆLI J= F T3aUaV / בW~Z,EϞSh,91& `&u'&duX$ku,>zp>ڜDvʸ,#znbbA䖝9ag`#|`<wmhTs}¡ZAQ.GI1i/ZI0lj.&GH~qrQBL43(_iD5I1 B?KwGI ޥS\>Օ>\ZrA.`xGLic{wond~_*6!|tlDľQ\Y5D>(Wp'>i lOj~Կw y9O9Y0Y4^V{4CY7C:GD"td?j>J:MCu1@([%CLyCVCq2t-3=P/A ޽& zH<[h0vxh~}L63wRR};;_u<^W$ Z AGHݘCjZ,IC- Fm& 3l^uFqgM2]iԿQBy8ˈ3U"[; Yu]q~]*N'RB1% hfvai"{cL.;/FnU71Ff3@?a':/ϰL598 c_큤Bl hxkٜ *F-sm-mRwJG 5xz}ʴ÷w2RVR0dj{,dfqP@ p-ݖ+a90i^P'%{Ș'*6sl3rMN+10)6>Vr]eJCi^lnpRY0[V%€ v12lMkEoُ804E'>ClxV6D ! ,- Fm֨l(ޗ򾂦$-IVk%}##d.\\IpB?.\/[ \?M(g^7AN.\+;a= Ԏٟz{*AA͐ŕ%¤>&`)koW[+2=JfC{?ʨO'lU|3lC|E!ZxȥŪeU&qͱ8gT.Gw(q8*j$^S?J3]\/ X\MύAeIc=&w6'^#$\")F2wI` iYlQ::u0R˽DPZ˖s5%i \  j{B'ɰCi"̜nXJI+Nos1B;"xd%LΓRsم(@O= bBthյq1;4o(nx: cU8x) @rK1,4 n FjJ) {O:c{`DOjJ]P‰ү*o nv9RY2u#x,4ew[*ύ`ۨГiw0-5>.1X9"1Cpn u xxJ&h>wUӛG<]=k-,om]: aFw57w3)€!%nC#_.,AZPts9 5&C#6 6Ž3_bbp`mXr=*G=c}4-`qܵIqřGs7\\S-m˄R[[,f,'(KnXk& 4dq:}{f.B^<| )mN=ב/tި$ŏvEBYdj{N>'պMl@Yb]V^Ȋz0^9톔+61`!kP+cBN>EjDp~_Ua_@p+cHC)9APc 5X9siEjW17qNKoύUpU ?hfN6ת#1*[O2>lEi/p s` êH@{KMh;CRսڼcNd~)D%iU*iM b/brB}pyc@cA.c+O^ A|(V V123wtX"zTSInA(]xxS=.QA!t}N]T"kM'N'v>AA0V$fP*f.*LH Rzwa&~~&7UfBJkʙ⛲n1k=/1q2i1`7"B˵bG׎7ڔ5E y}:z PL^9۔PhyGb-k_Tў@ɘ={ۗiY<ݐtEFWC8h<"IB2_i$:0yH ;l 3P\ϡ;nY^w`dvB3Y6Ϳ3rmW k;zC?G)J3)ٲ/?(1F[-tZ??9/;TiD6[c(Z\nv09Pbvo1T]~,V\>f<]g S, fV[B#dAT5矞DizB&v$cFTf.ϕKFOe)ؕҐTofVLxeFn )8T'3]JՃ~=)CrEDZys #Q33_AW;r&k.=: 4 ]+ԍypyx%t6i`)ߠt\h<53!f1]#TDAR)яR"E4xv?)3*L@ Lt95 kClcRTz ZTѼK)g͋#n a:ٙ1`޵j_&Kz~:!~RHbʭt,k&> ,o?3t FY,]ϚЗ}d QBgr] ة 7|IǛ&B}lL)ISoQ(w$gş-&wv㦝b}K6r'lOTS_$ O+V(즎is~O\k) ,MNcb1p?c Uy*QC# oĬ ~gdquͳ+kmD5fE1:̋ cѰj4 *y&2 @;)jU lBmg3&K"Ù8IjU& ;?XUbkxd[&ByOK⑈:uBcSC] ;;OzPȁaS_D#Qa@ÛtV%rx6€0+mQ"қaFl-:Nca"oQ$!DF;4X w-.Lwl`szDS1]JF!J f(:gsWpR._ЖɎFkldd) $\ր͕4")>M"=.VD% G G l 낛jJD"+X1Ri$s(ϜyHI 7|"5'Zxgp ڊ),t^%!YϣjIsHG 5Is׻DA5OۻVbG_};&<@~{ұX!0ZgR!3:EC-.I;6K_kHr "Ğ)T6l{O@6YFM0U$mCf<$u]B:p[-!Wg{7R`?;KGs:C554iYt}@SpShPrف9YПjI-gOxJv$e 2GzH$ k䋄$GA dIUK;*$|%O6!V W\07xٌ32B82q,dP_wvUnE8isYp: >UBrGhDc^* \n5XbA6Q0_%"}65 Øܿ*PEd8|g{5c\#[&{o% ZϰC,O /u첬BŇ |& !Ϣ~E's{IPtbCBbHЗs16M()瀰Ex@=Юȗe,u!yLRZ#ND=F2BW1BWoL y&c )aEhkr͕ZW+XSC]!qɒ p1y'h̙khNM=-@֭W>SCͩ\OJJ5A|'G#ɇL Yv-cJ!Ń5uSFWBy5ejÔZW9"0<<]E9t.ZTV9bsqn+ 92 @d`mmE-` tCzo@?۾ٌ%[)v1)J(x_e&6{޴2bhR~{!D23@BǪ1ݬZұ^]Y$bXfӼ_u~jL$rJ.dDH3V㗨lS씝+ H,0%eXGFp"ՅS|dt _C[ Y3suB:yI|N&iDggEN/OK"LfZlTU+e19',v5ɀ!ǙȀ(Dk-ŷ [a45a"Ui ]L /N5"?T0ｮgA7Ѭ LO^w btOi#7TʒũһX0Qx|vqpX1H qc]n[A׿eNGr߳]MVlGWNayA1lD2=0>TF%Co3; o(XPn۽/PTr-f > D\{L*+l^toGDM ]wŽ_h5VV3P Ns@bbݔ7 ֣}D}+vTU.z@i>Įgͽfl .^!{UjGIj51Ԩl%s.~i6 8Kq Sւ'KarAr[ސpN?| Qz|t"+B`J p˗:ʎ~0'0j]lMhF}"\ɞlNG V.B [`٦bv T2VD[SIՀa^3JEŅeJ qt@]+j~Mk]MB0'*]Մqgm"\* ܍n#dP;;rg,,3ʂFf%<\!A$|B#AzF߉]صg,ǂ40w)Pw90s<18} >WmZB.L4熧G~#w '[ asy+EG3.&<@6bGvN!_'.y*ī36%c Npʊk"6}os`^~Ȏ"mc,*2) J+%=#DO5 aQ'SD y=۹g"s6}pݺL8n;췬[aAB VwL>bJZh̅'d"ڔҾSOJ$]m  úaH!FDrU!vrn+ü"vb^Fn?joBWy`eo"6)*-0'`S6YR+E$t!LAdoGOGUR0|m?{,x]^T,lK]YdC.KwnpMC;=RjB8nt3Qg/[hya&!.Tm\ESgJ7D⌠ٳ)hq#"[o^,XS؆, `mēw1`2R8L1C3{n9tG?zPӪT 8pMz7uFcY|+tK:Y\ț8~^bF 0hf׆V*s\>r,:WtqɹXLEX<1'W[n]LڵgA( 5{e`I;/}ҢÇJQ)XULب0pBb1'J4`HQnϩ$Xl>1(Ko\ByY0W[^ČfMQi6hhVMG"_5p/I>@ \iqQ0%Uw!Xav&~H/"Tj5\o>Cļ8JH%vɫڋ*,7@6ka ]a 5x6g~޼:+Flg'֖q`~DŸSK6X[MuckO L=BpH kFUvӓ;Ŭ#ReDq`{0 \uvNM1EP͌⫝r 1U<R,.'s+%BX+QHz#.SD6× &ӀOP{M~3R=ADؓEt^*Je/qȦUv|jhRKO rBz=`Mum7|ͥ*qb1AL~lL/zߩ-0V PV܅>[s޻UȀC2B~.W$hE;TUWm ϭ_ϣ>J8nGkcR(\ ='usd|y[_ÈМDVn]`z$9׽y+芜v~Z6TGqñ8 Yf4{B5g!9ɕip7g.'"*}ߙLXbPaV:t iVe:80'Xɍ[,1ꫡ_ M]^:&x)FAkaAd;ݓr+e&b>6{|֯Po_ //kD~i25CoɅOs{VyiW'1 so&?,O6hu4KsLFvSͳVfvhz  ֆNJ|BT,H\,'p=Z:CߗU딆 lԟq~.>ڿrULÀe38K#%*"qQ]m .t)8(!ňZVNCJ.0Q[` $FtڑoYH:p,n;#U0ǶÐhh9`0"'7M&dJ;<&)4=+w!}2R97kcJaY*aA!dFvK5$U:x _/E2eh"bq2[$z{=ʤ &lN͕꾱*w>j0) Cˣ2IV t V俗21\*#;ݻrMR$7-p`!EoFP?W$b$ ٗOaPͪ ۂݝ 0;x)J֤y^dJԦ ?&J3E TD%Ә,9E9ё ED(T(Ӕw 鮨 -s;n(pr=VYٴ=:т@'#WN") MUMSBwH%C OYGA eșZ -"B*wDd<Մ@ng8 Y TA^ U)q )E@-'ON:S!I,y9DQN;r|~ǻ'ÃR4Ehb)ya$Ϳ[Å['WWTP*kQRm)VuxoPfefX8wq}nRHJL%RD;폎K>WĖkХb%(N]KM7I:[#~pQ>j- >W " Ěw /3fRKl4vU0jNrd ;Y@9LYzxj*R*̜fSIr> \$E%:v+d#+MwxY?.G\,3.z+H_=aXX7F$r߷AZS%EZ,MA %Pk<8%]X.ʍX2RnȜZ;| 5meVX?})ǩn$Ha0! [=;' zr}PHt#j< !2qlҩgG*&Bmx[KKb]?v2}jQM $'_R{Cc'!g b5$8l&ֹдizCZ^'1^&y7Jm-9ֿ $}VD*<4>mY̓I `ܕHêIBu;֊Q9*usw 4#JL +'VAmGs&Bw] 6 yUZ|m^*_Έ-7TsA' oNޒH%K1G\d#X|9xls"mބH3:xCy'*m\(ICxol3 A=|}GUKB 5u(Tl#5]诚!?X`X(ȷ8 2ʉ< $A\r̡q,"$T[.(v'uXTGyty9wZ.~Y$}jLwa>H<3!IiiĊ_/{8~Na[O2{v՗,C U@# p1KR5B=lP l_B!I@4>9ݰ]̳M$k>4j]BҷZ/[KLiCG1v,F״TUM4$ۥ!F|2^#N}O DU,6:B6bs-K 9H*mw1Hn]}$cO&iݼG1^mg{̊}]4AFgjx E;$mWu9@D}a<l&Qu "Ź;Yxh g5R?<"k%ui7!myz ]E3t|ڋq򒴴;%C5vZn{AZRamxDX6pOac'gӾ=Hќ?)t x'v)[xbnq4‰,bk_ CX*L?*eٗijP"!N(pjh4#kcGԆK)=X^ 1g+ :m~tJژ1QNw3i[ K0w1QcT/$V%jl:"M85>!>ܩ[A+XηB&>%' m?P‹Vd*@H0` mĝpjm9z<ʮx 7ӻoZΒG)Yͮ vkIwG g!qy1$h3x+O뉫^lҭ}>.fFDbg1UhcEV,w@00?zѽɛh>>Jӛ/ іq(ceV@eWeU!rt>"p<L)AǓW:P⨼ԉw/MKGZ%bGPKB}{fW*{R-6Sl(HJ|‰܌A j63Ez|ч[ b'`#v3F}h0B<eDbJe00zYϊR(d<|[b"Sn08^I$W< amQ3W~?@69bS b4BX١Bz-,m3C58 $UɯŨ?)lm/}gzéK V֣VWوuOns6/4̠)45Lceƺ~ⅬQg|r v! 6?RrE SA.fva 6Q {~Dʣ0a´둅V$Ls^_1.}oAz|$kK6F r9W.+IZXp`x$XIiu;JY8Oe WJh] :60UV%;d1Gr%kr7}R4ifVFp-=\4;? -JgɶtʘOo"WspǶ1b{ kWQmm@j`6E|ny$w=v:yʖ-+\,Ƚ4GVME7-DT ش (56imJ5٠HwDzS&aH@A@5p5z;mfp yZco1鴐t`Zz_a\xAqJa%Jz3y7iORЙ7"پq~\-p0MGY#h7-}3yf.W ;+caϮ#pR5Oc31Hr. PTbKW0OD'Y9˩RYKv-K0 Z,zX\ 3nA Ykeeux.khƶƩT5T0YGKj&gL%aPfs,uЙ 6Q?ʱK0_B" YM%ߞ_/t^ rSv,oX~}O$ЭU"ţY1~&^R83y:: k!"1 .G2HrqdK#Ѓ|d< 9y%D")"y[:hF3QkG>pq4&D*zh0Q@0uG(-8NaEOFr^aTw N ɱP};B<WleH΂s~UHԆg +q?t @,2ƴNY , ! O #t)a0 8BF*1ei`վ\G&~E=.K4Vj Xn Ӟ:{ǎK![%fS@8Zj{”m6B1C*p+roǷIKc);[4"ʞro#obQP^!uBê>]?7ގ{E:xݟefo;j䰺Wx%u:YR-6m4&>0 1{T([rL^Mf+O.҈"; *7/aaۇVD"8 `5NAHjM߻c[ǥFфbf.oCNnVwK~_Z Zja|DvkT9 :MYkH}2{R3֟wZw#_Q7X8h6FJ P7m2y@ozz" 3ZiK${kz-ënC‰kQ."r/kzVc N!(ZGOLxQ߹%F"4Ie^IߢcAN  z蜡Bvۙi99<ޅKJ} fM36HhDfk] ݧQ ] vIz,16r.8pqw b*A4:#0Eڲ̲AY-R#& //TNjKGg R#Q!g-Yq쬿.45u ]/ c i[;sC ?_4/CŸ$HY͘K،#ۣVjfx4 w௾1\rjY3h 8n8)oY X~+;bm{&=Bi"n U٘IxLՅBs4sSe}DEjBCǩ^fdNYhȞJz~_$=boY#IkRaպ"4/BRG3rA6XVI1@IX关#]㭚k%YZEn jʭRpDT| #گ.czO\k6Ju292] Q/3QuƪI#wd1i>=5>5d;bEo3ze7KOY&X9<,w'$;|q uOA_ qBa3ٺVՊPw*0Bش]@X) _'Z ]sf Sy\uI/<5a݅`:>خF*╟#gzY(86-<&ĵsTATs3e)ޛsHܐb6@y9:˷[uE-:zMpbܽ;͒&41lR 8yP*ȲF/6j 3,0ܨ M[2'xwl@ f_CNdH}a`sMavvT~D }!e!P>BqdL{Q.-n@8oiuƻ?qr/^nsSz[Mysu (FFsj`F JrDJLtO`ֽařs31P"/0r{>SAg~4e _@ 7i<d /T*o_((څ X&uvd i묱ʳChU&J)Dſ, bp&<΀x=im#CfDb XaLՠ\lNV[wn@]R>X}A`ohؕlbh8 z~uXq;ȻݹoF nzI`8DxyNt@)c35kK/ILuqz?R6.r`%ѐwlR f} 7Pt[E<( &s2 G!{ ߇9MW3C7A?b +0OY>NAupjJ Ңy%S(]6'z mKU|#OzЪ:ƚ% XbW/Muaڮ"ޖ1(a\z~i_ ;)rQ,wO&13r+شX4x"X2PVַWi}DryCme帿:yJA)[\t&cw:> 迭^5w ?]k*;e.z#!DsAmhF6&4E=fPJ7}}5?fOq7cH4k2-,*04#$9'9Z;Z\A_(;y3\7s}k3@r-2ưidkt,f#%nb}+jȇ*c~Hrj;hq`̀j`Zs DnSU㦖ݽfH+amY-F-7Ɛ }m&V2{ҳ'{dh*4 +s]x U cyq;Ccz[VvE7p'da/ m$)_X}Oa/Dж%'~͹7D@KD?Vig>H8F"MT.E(j:@HfI92tnFˣS|+n B;"*+ o'tJ{&? ~ J[g}ZJrCmynCBCF R\pbTNm^?R-RI*6Q(msfGȓ4 4mh"uhZn'c4Hm浓h>vf P0ωmCiVDMI<=XE &qb_k|)"Q_'UxdRƒo;*WFٿjB%]POڥBAauzFBb*79E󓘐 3',TuՆHϿ3)b\a;FVsVhטԭ:4+8\ђ,l6ҸWԭ(pc?2xmx)4&X&Qti+;21r$:FE~ctcIWIιx<Q o% **/RBQֺ[Jd,NnvmtQ M6S]al,N|hKm }+r[d"cp c?]t>1R/-!wV y 9tk0|Ei[nŌpPT{*"KAyM; ゎ`pmgƎy?SbT,kqGGcx߮-9iy #g"e?jpKevl?xb'ba KA>:nnX"1qS#k+Bd„}]&'2pT|ݟVˉ1+nN4Rb)Y őe(S3{`Ҽ8*~LNG8 /)T s֮ 4z+;" i`H_Y×e]=~(K>N尧]S2^!P=uጪ&0u5Xߩ܎/n=MF2a򰳊#!m(¬ +rԧ¼ubs ?q;%ryyKw9>a5O,,_\|%*[~"t)m@3]6;*QkIRU:sv3QdQn}q Q3_-IMaU łȿ/\1-09o OUh`q/x-&}[l6x7m/w BL_7ws7\gvM C6#Ig-_&@Es e s^dߔ?qř tYqK+#DZSi*;E cF0X 9YFBm󡋚1!Յ2zJbA?>B_-^9j4~@5 TstazdUrJ=SģY(mca6U,h& B4α:&zaIa~FI;p%dC^L J)b9<7dpUW xk  gpChi[MNFjn#{7|aLf)G*5*Ͽw}jRoLd[Oe)}'Հ@2>}pY##hY]58RWӥ9 k JR";+ӝ ԋv@8{kj#L?G SrLXr"G,+"'|Ji*Kf&"]l0퓸 [yDb'N^N;qb/:ƈZ9gAjްRZ*_{א{|ɣQ˪u i mY6ΖQ6b_F̮q6!Hrj-Z"|~ %)Wس r0v㣳1FΒ \5ű`̝8';w`zQ_} ^y#k J*V8[g r}B啀Ck_,qc ߞ++ p:Ohvt.,$kLsÀf*NtA lRv@:@\7Ն3_"c.:h́2fec}^VA@z|H L\;]`ɦ9oނ8iLjgC*KeU,x>+ V>qz~eoIX eŝ2T~R1/UΒJ.;y_<  ^" #󤤙{>! 9߳X,MRtrb%m |l}f=:2)IA_K,hzUDWSp0t'/M#hB=[/7m$A:}@Nw= e3WTiEsɗ+t5=G\}2GVEk_{[ !+,HI\#hf';ǭT;Z' 5I`bT [=:e%#LzZ5թtްY}_jw &61zz6xj ;v:k.5^2Efo}&A,듉:m(CvpvP?.Q]0-Ej i`b2&? >?E$ (x&zMsk?0)H➵j.^umWEl hd!ܕVM++!#v&vU5];xɀ  fC:s/BF#/㇠k>IrZ96ր+n*F:p+V Rm--WTqĂ(KRAf̈́Dm(EGqaOYt.~[u(~PNujm>\K›laRwV]N6Cz"ҮqDM<;0+L#&f-es70M!'GCe|֫DžJ,!6OU,SaH9H\ޞ)jpq4Y}~]@ʠ~";?kԂ><8(|xL^A!,_dVsmZ߾("sv\ hXK5=Vt*h-F t5pFj#SI%.eF.j~Qhw&aI\ٳ%HBH$baiV Ыn- 0bzki-X ѥ@/R t?l֠5Tjzk>삒'-cnWajPP[m(-&a4cT]ZeF{jЍ Z[2G9ƥD7ZhEr;dtV7#ڠpYxd_-yHFbtLoݫĶKow|][}Fh-SsK@.^F6JJfn (R6=_wOwa`;MXxJ5cw<<QѪYh(2ZTi:] P%oNr;M4Eֻ#;#!t0 c]FtsCgIē(Y^28l%?]=mnaU3mpa ]KIf̱#y4qI:/f =`ʚXR{h)4?Hjmn%7RΥ^&&s݉Q$_\⌔P2ҪsFsZm u;hWbLZ+:o:#0rM) l_scEk!Dd\@&:p% om{iF,Hُ/`)V9INZA:]I3 @Ӗ 5)qE@=2GyiĹiiQcC zFsh3:]p>ϼjÔI=Z8WpGTMi'/G&7:O ~@zŘ4 *0r]a'翭Di `1h)^_~rwu$ܖ=}DZ9SƯpΤ>k0 v '0TNS(N4-_U[p0M7:b[ @;M-6 ?:h@D7`}h/X5`4~'| ɞD8Wf`P A(ϚI)EnSbtQQp2HI µ%f`q4Ii) ^CEP'Jkq1=ߊ۶Awi",PXLpc%SNq҂&NUuH=H3oK[ _0rtq nE-Ҷ݅'*6zs[EnC$%РGx*)Y`lpBʒ^OC];WKCgªkk/#\v!io5**[{߱yV6^qD- H2HSn9pzSnmԽ򄣪g*/u6MrX|el52,ͦ&Y: B߼eU> f@Ӷ>;>2U^-%_[o:oDˆA%j2z$$5ήgaygVݼ|r5GGLY[Ql>}@VR {`_$1R܀fq}Jc^CKJeg.޵*oI|VPe~d!;<jl9﮳M$4 yn`T%-|2_^| %o16#>dM_;8톺 :"Rj:0jBP-`J/6j1Z( Xůg< X=ɂ\&{%|UXnGFtLee$)hMvXNƹ9:a-Sk^w[U"N)zԝˈgb(,)\˻g{z)9|'Lsbq Y#=<.EZQvQʠrPĚ;6a tc*uv%4#k>HD#o~&_0?80p?R06H9 H>ZB-OS|?cIe-SGK0`?9"fN^#j WA%qdeaJ4hP4G<ލ-#Vqg(:Ki\}}驄#ӟ;;$u-|o- zIqOqHdY@5-R5cbc/.X|>VaJ :<;+6eQʐ.sq$&46wmĦ0WtRdq p5ITEuq#Ғ:iJVHRMppp͏kשg DLuh s糒4ݩqsXdxHLH%l恟C 6&#IY==B2g ⷠ)`t\nk:h~k9TMZPwA%lo嗂o~s'b3MgΡ0hća; 8VMX:]+/¹*U9_yZ4SLC|GS6~g/rRN8obG!$1K/9DRg=aE~'9Z!#\d,XL; IRCu/b_+i3C+{3dpej1#D :.}DHtGVF$eŶK%GMSyxDVv)P-=j#ܝ* Un qWQfc " 824DA!6i2H&غZh UJBMPS)֘!SI o}}4l沣q7:rUY86)P7!b6T- ٻy]0ӝ>ƧG{;j`@70` ֚hh6wTf]T7`c H8F)=[vE pp&wL$q[0΄A/>UU$3mN(EwIs24L`ScA@ LH& [KNI dZGpv{ hٞS0v Rӓt`1E eG?X;>٫h}i݌47`D$ \NH&.Y}'2_UݩA7GsO@jn[K h;HM6wLsЪCqt#d/1[yu/H` ܉nex*dz%z;124&|# 3nB&GCA;(;\5_Sݾɍ3ͨ,bSnmUVĦQBkmD 2Oa \8bTQ7+.v72F\B|ISĭ)6cZzQ T@ ax1ƞ4JV5Yq^{RAxy. 6$@{Ĥ]6\˥Y wI5gވ'b]6tk<^̧AТ-"t{xS_p?[.9!zbv2#2Юma&rBIFGzU(wzk:gy $}]gZ{ > U i3>$0(>ǘ-\$l}/5r .S.;uշIjc4g_-tȮ8eJsG !'޹؛/I_;gZiooCjPB/iݠ/oda؛fz!4qa#φ˅A٨sH߸) .tPu~2*'\"m?e _*Ja]b/ƱƇu}D#,T 0BHpFŨkP攈V# I)ic# hg@te ;]"-^PH H)t˙$$*:o/V-rC iǶ.ieYWMxDIooZD1-y%}<n4QnC(H5geMk%wzf {vDT[(a-MW"ЬkURz2^z|{ 8@ك](w'^5G9A>XZbՀz $qV֠l@Vu|دtl :4a?GWD y=ys/ )uS|75Yô{ƌb)VtϬmB'+(qsg%*PXdD~FX|t$xRݏm5]["jtx`'9n¹Xfr9צՇ"Y aFÐ^ftͮxeWQK.o-bY9RL?G\]N<ȣ7 P*No_R;2\ #KC] BK 9r*jڠϖ 9ek6 \/ --D1_Im,Gքf5oAiΡ%%Gj|w ż̦ R72Rpk Ϛ\({+=!eKZ':T#pv҈V{Ű0WN;Q]HO45mh2pҶ"į%DJ*B[a8N&g{ZrBXMףl&WoE  pyA"5Wʥ|16.2;Cuc' @COs\FŹQ e6{ED] yT-d1vu@CmHz`UB3m=6^~ >vFV0F*!Hi$&^ơPu4#KƆ@ybMw߀Vx&Yڟ'8Up YZ