texlive-fancytooltips-doc-4:svn27129.1.8-12.fc22$>\`-Gm < 3>4R?Rd)4 8 Xx|* 9Qiox  8  0 p H   P   ( 8 a9 a: 9aGN HNlINXNYN\O]Od^PbQdReRfRlRRCtexlive-fancytooltips-docsvn27129.1.812.fc22Documentation for fancytooltipsDocumentation for fancytooltipsV\*arm04-builder15.arm.fedoraproject.org Fedora ProjectFedora ProjectArtistic 2.0 and GPLv2 and GPLv2+ and LGPLv2+ and LPPL and MIT and Public Domain and UCD and UtopiaFedora ProjectApplications/Publishinghttp://tug.org/texlive/linuxnoarch':Pw&ZRg$ OA)ZWc *JA큤V\V\P P P P P P P P P P P P P P P P P P P P M Ea038b83df55fedcc25287704e0637fb9afa107dfe573ce67e827ca2b96de5cee795fa88641ba42671a6b9f8690a5209b7755dd4bdb9231c9fa05d7da5fec956007cf7ddcfa2143f59193c29ae4c4d1d4654451a86d8e65fe7226f0f2026f5ba40342b462f9f734a70b9c80866b62e207eec7aa633bf9eb1cde8d8dd2801c357aa5403eb08830a91a86cb0c7ec12e7b6c96b43cdccbddb90af7bd0449239f40f9b75563e41656581abc7a3d4f5c6eac7c12ce5d6112a6af099c0ecbcf7ffd6e12f066672e8b035d4a9ae8c62ea9dd0323a465626742dab6711558250b81d76e6a3734b3db8c1c3820fd8f1dcc1d232e9b671daff074f41cb81d1cdae3942a89d75086f7cccc0056d5c0dbfe3e56753e241e2193639b4b47c0e2b55e369d9cfe6530b72c222b8a2126a99d6c40be5613e6231cb912f6c1f4e9acd75b17d3a9ac463d8e0b466220d897fb6dad1f77408cc9dc10bbc50989f7ccfbcc929f0e79291980ab3a36f0634a4fd55d0cebfb8c56bdd2d3acd1992ac569299575fee01158f3695a79bc527821ec4586d84c9b6bb543c5373c64ff7e94e3b9f15f4fb2e7efb1c865492f7dc597f5ebf9b66607bfbfb9fa32ab45f3192bff70e10e6dd1ae851b9fca74a30df2d1e24618f40d55fb09130a647257c2ae4efd42c2f5119e602bf3bd4b2dd0e7c5552e1dca9902e033a530c27014b39779c0dd4665c414f052ba8e7afa50df1a0d0b15c8d828b0c5ddab064cc73bd51ede278a6e149ce3ee06ca60ec005161a6c7329f5825944124d831f1d5b3107eb84b74cfbc52e8bb04f3fdd45daa854f829b2eddc2b148c692e3506bcd5565d49ddb0d806f0a3acff1b225dea31650065c778ca80940c04483816246e760d766ec79f47aa01bdfba3c271a26ec7418a5cd716341965608a500809fa6b2558d94fb40d335e6795b068beda096e828830e1206599cbd1f90341a8f95b0e0687c1da46aacba9312102624bdfd27/usr/share/texlive/licenses/lppl1.2.txtrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootroottexlive-2014-12.20140525_r34255.fc22.src.rpmtex-fancytooltips-doctexlive-fancytooltips-doc    rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.12.0.1V\:@V @U@UYU@TT,@T7T@Tw@SvSSR@SP@St@SsZSr @SG@S,)S S@R@R@Rj]@R].@R].@RW@QbQ@Q3Q@Q~`Q{QR@QHS@Q=@Q9Q@Qh@P9@PPP!@PPpPPAPM@PXP@P@PtPp@Pl(O@O@N.@M|Mk@M>@M9ML,@LL6LL@LuLrbL>@LLKK@KKEKQ@KKK~}@JUJ@Jx@JJݦ@J@J@JJ@J@JJ@J@J:JJHH@Tom Callaway - 4:2014-12.20140525_r34255Tom Callaway - 4:2014-11.20140525_r34255Tom Callaway - 4:2014-10.20140525_r34255Tom Callaway - 4:2014-9.20140525_r34255Than Ngo - 4:2014-8.20140525_r34255Ville Skyttä - 4:2014-7.20140525_r34255David Tardon - 4:2014-6.20140525_r34255Marek Kasik - 4:2014-5.20140525_r34255Kevin Fenzi - 4:2014-4.20140525_r34255Marek Kasik - 4:2014-3.20140525_r34255David Tardon - 4:2014-2.20140525_r34255Fedora Release Engineering - 4:2014-1.20140525_r34255.1Jindrich Novy - 2014-1-20140525Jindrich Novy - 2014-0.1-20140525Petr Pisar - 2013-12-20140512Jindrich Novy - 2013-11-20140512Marek Kasik - 2013-10-20140411Jindrich Novy - 2013-9-20140411Dan Horák - 2013-8-20140305Jindrich Novy - 2013-7-20140224Jindrich Novy - 2013-6-20140217David Tardon - 2013-5-20131226Jindrich Novy - 2013-4-20131226Jindrich Novy - 2013-3-20131021Jindrich Novy - 2013-2-20131019Jindrich Novy - 2013-1-20131014Jindrich Novy - 2013-0.6.1-20131010Jindrich Novy - 2013-0.1-20130608Jon Ciesla - 2012-25-20130531Jindrich Novy - 2012-24-20130531Jindrich Novy - 2012-23-20130506Tom Callaway - 2012-22-20130427Jindrich Novy - 2012-21-20130427Jindrich Novy - 2012-20-20130321Jindrich Novy - 2012-19-20130318Ralf Corsépius - 2012-18-20130310Jindrich Novy 2012-17-20130310Jindrich Novy 2012-16-20130205Jindrich Novy 2012-15-20130131Marek Kasik 2012-14-20130102Jindrich Novy 2012-13-20130102Jindrich Novy 2012-12-20130102Jindrich Novy 2012-11-20130102Jindrich Novy 2012-10-20121205Jindrich Novy 2012-9-20121120Jindrich Novy 2012-8-20121115Jindrich Novy 2012-7-20121107Jindrich Novy 2012-6-20121107Jindrich Novy 2012-5-20121024Jindrich Novy 2012-3-20121024Jindrich Novy 2012-3-20121019Jindrich Novy 2012-3-20120926Jindrich Novy 2012-2-20120926Jindrich Novy 2012-1-20120926Jindrich Novy 2012-1-20120613Jindrich Novy 2012-0.1.20120408Jindrich Novy 2011-1.20110726Jindrich Novy 2011-0.2.20110313Jindrich Novy 2011-0.1.20110227Jindrich Novy 2011-0.1.20110120Jindrich Novy 2010-14.20110105Jindrich Novy 2010-13.20101215Jindrich Novy 2010-13.20101112Jindrich Novy 2010-13.20101102Jindrich Novy 2010-12.20101016Jindrich Novy 2010-12.20101007Jindrich Novy 2010-11.20101007Jindrich Novy 2010-10.20100814Jindrich Novy 2010-9.20100814Jindrich Novy 2010-8.20100715Jindrich Novy 2010-7.20100604Jindrich Novy 2010-7.20100531Jindrich Novy 2010-6.20100521Jindrich Novy 2010-5.20100430Jindrich Novy 2010-4.20100421Jindrich Novy 2010-3.20100419Jindrich Novy 2010-0.1.20100416Jindrich Novy 2010-0.1.20100329Jindrich Novy 2009-3.20100326Jindrich Novy 2009-3.20100219Jindrich Novy 2009-2Jindrich Novy 2009-1Jindrich Novy 2009-0.13Jindrich Novy 2009-0.12Jindrich Novy 2009-0.11Jindrich Novy 2009-0.10Jindrich Novy 2009-0.9Jindrich Novy 2009-0.8Jindrich Novy 2009-0.7Jindrich Novy 2009-0.6Jindrich Novy 2009-0.5Jindrich Novy 2009-0.4Jindrich Novy 2009-0.3Jindrich Novy 2009-0.2Jindrich Novy 2009-0.1Jindrich Novy 2008-0.2Jindrich Novy 2008-0.1- actually fix newline issue in pgf- fix rpm macros so that the right file is copied - add Requires: tex(titlesec.sty) to savetrees (bz1266801)- add Requires: tex(ltxkeys.sty) to xwatermark (bz1197494) - add Requires: tex(ifnextok.sty) to titlecaps (bz1186688) - add Requires: tex(xetex.def) to xetex (bz1155267) - add Requires: texlive-texconfig-bin to latex-bin-bin (bz995752) - add Provides/Obsoletes bibexport to texlive-bibexport add bibexport.sh symlink in /usr/bin (bz979448)- fix newline issue in pgf (bz1241458) - do not require: ghostscript-devel for texlive-pdfcrop-bin (bz1229407) - do not provide: tex(ifluatex.sty) in texlive-oberdiek (bz1146684) ... but do require: tex(ifluatex.sty) in texlive-oberdiek to ensure complete bundle - add Requires: texlive-metafont-bin to texlive-kpathsea-bin (bz1123096) - add Provides/Obsoletes texlive-tlwg to texlive-fonts-tlwg (bz1100984) - add Requires: texlive-greek-fontenc and Requires: texlive-cbfonts-fd to texlive-greek-fontenc (bz1064051) - apply patch from Edgar Hoch to fix etex.src to permit \addlanguage to have empty params 4 & 5 (bz1215257) - replace visible references to oriya to odia, add odia as equiv lang to oriya (bz1040337) - use macros.texlive file as source10, add and cleanup macros (bz1054317) - add Requires: biber to texlive-biblatex-apa (bz1048193)- Resolves: bz#1181169, insecure use of /tmp in mktexlsr- Install rpm macros in %{_rpmconfidir}/macros.d where available (#1074287)- rebuild for ICU 54.1- Rebuild (poppler-0.30.0)* Drop scriptlet that touches /home. Fixes bugs: #1128240 #1047361 #1073518 #1054338- Rebuild (poppler-0.28.1)- rebuild for ICU 53.1- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- Tex Live 2014 is out - fix package dependencies to make update path smoother- update to TeX Live 2014 release candidate - conflict with ht package (#959696)- Do not export private perl modules (bug #1085424) - Build-require libXi-devel for xdvik- remove explicit ghostscript-devel dependency in dvisvgm (#1087847) - pdftex now depends on pdftex-def (#1096535)- Rebuild (poppler-0.26.0)- sync with upstream- do not attempt to built luajittex (#1070380)- sync with upstream - fix fmt files removal- sync with upstream - remove only generated fmt files upon update- rebuild for new ICU- sync with upstream + add BR: libpaper-devel, potrace-devel - remove generated files upon update to avoid 'I'm stymified', etc. - update co_source - upstream SVN checkout script - disable Perl dependencies generation for F19 and older (#1023876) - always have format in printf() #1037351 - fixes #921805, #952080, #1020941, #1025679, #1045794 - Merry Christmas!- improve obsoletion automatism (#1022291, #1022746)- fix symlinks and dependency generation- sync with upstream - fix bin->noarch package dependencies- sync with upstream - fixes metapost, siunitx, latexdiff, luatex (#1016074, #1013367, #981390, #975254, #976863) - modify post scripts (#968573) - fix kpathsea patch - fix euler fonts installation (#982887) - fix license tag OFSFLD -> OFL (#1014052) - process perl dependencies (#1001434) - don't ship flash files (#1000265) - rebuild should fix rawhide poppler deps (#998696) - fixes build of dbus-java (#993438) - texexec no more complains about switch.rb (#993255) - bin packages now require their counterparts (#991699, #988978, #984468) - bibtex works fine now with spanish (#987534) - do proper obsoletion - include epoch (#983433) - fix build time tests- formally switch to 2013 based on upstream - call updmap-sys and fmtutil-sys for map and format updates - bump epoch to be sure all noarch packages get updated- Rebuild for new gd.- fix luatex breakage (#959625) - fix updmap-sys calls (#968573, #968573) - fix broken dependencies for packages only shiping binaries/symlinks and nothing else - fix update path - obsolete dvipdfm (#968358) - pdfcrop now requires ghostscript (#964183)- don't conflict with ht package - ht binary is now called t4ht (#959696) - require coreutils (#928566) - update build scripts - update symlink references tetex -> texlive - handle texmf -> texmf-dist upstream move - do proper obsoletion again- obsolete/provide ctan-musixtex-fonts and tex-musixtex- add missing shebang to context script - mark language.dat as config file (#929367) - add scripts for checking out sources and CTAN archives- bring chkweb back to life - fix context script (#924918) - prefer scripts installed from sources than from CTAN - BR: ghostscript-devel because of dvisvgm (#924662)- fix wrapper for context, remove chkweb man page (#910952)- Remove %config from %{_sysconfdir}/rpm/macros.* (https://fedorahosted.org/fpc/ticket/259).- run updmap-sys --syncwithtrees posttrans (#915086) - don't conflict with other packages (#913678) - obsolete tex-cm-lgc (#907728) - obsolete tex-kerkis (#907726) - fix clashes with xmltex (#877690) - use fedora latexmk instead of texlive latexmk (#914689) - fix broken symlinks in /usr/bin (#910952) - fmtutil doesn't print jadetex errors any more (#875266) - fix post scriptlets- fix symlinks pointing to system utilities (#907643) - add BR: texinfo because of makeinfo- enlarge tex(latex) dependency set, introduce tex(latex-base) (#904147) - fix post-scriptlets (#875257) - ship macros.texlive (#885762) - depend directly on texlive-kpathsea-lib - disable rpath- Rebuild (poppler-0.22.0)- make dvips require latex-fonts (#879661)- fix dependencies and upgrade path (#892054, #891709) - do not ship windows and other unneeded files- sync with CTAN - added new buildrequires - don't use texlive's psutils - don't obsolete latexmk (#868996)- sync with CTAN - compile also C++ sources with -fno-strict-aliasing - ship adhocfilelist - fix changelog dates- obsolete metapost-metauml (#573863) - update BR perl-MD5 to perl(Digest::MD5) - required for updmap - remove redundant posttrans executions in texlive-base (#865650) - own ls-R in texmf-local directory- prevent sed from being verbose in install log when uninstalling - be sure the old /usr/share/texmf tree is indexed and searched by kpathsea (#876710) - drop patch to fix build for dvisvgm, it is now applied upstream - fix dependencies in texlive and texlive-base subpackages (#875364)- run mtxrun only once per transaction (#865650), this considerably speeds up installation time- use -std=c++11 for all C++ apps in texlive to avoid symbol problems (thanks to Jakub Jelinek)- don't conflict with latexmk (#868996) - unify versioning for both binary and noarch subpackages - remove lcdf-typetools hack for s390(x)- sync with upstream - fixes problem lcdf-typetools tests - disable largefile support to fix pdflatex on 32bit arches (#872231) - put compatibility TEXMF tree reference into texm-local instead symlinking it to /usr/share/texmf directly- sync with upstream sources - make /usr/share/texmf visible to kpathsea, make texmf-local pointing to it (#867656, #864875) - fix versioning of binary packages- obsolete chktex (#864211) - make config.ps a config file (#441171) - fix post/postun scriptlet dependencies - all subpackages now have %dist tag- drop relase subpackage (no more needed as TL is now in Fedora) - fix -doc dependencies - remove (not-built) asymtote from source tarball - undefined catalogue version defaults to 0 - perform automatic license audit - include also packages not part of any scheme - don't strip binaries so that we can generate debuginfo (#863635) - clean up depsolver- introduce TeX Live 2012 to Fedora (#488651) - fixes: #619481, #759534, #814880, #819157- update to 2012 final - obsolete system latexmk - include dvisvgm back- temporarily disable dvisvgm due to gcc-4.7 compilation problems- update to the official TeX Live 2011 release- bump version to fix koma-skript versioning problem- fix upgrade path with old TL2007 xetex, context or dvips installed - fix package generation bug that caused some package might be missing from the repository (http://www.linux.cz/pipermail/texlive/2011-February/000086.html) - fix upstream source URLs- bump release to 2011 (we are using the 2011/dev SVN version) - add more file virtual provides (TFM, TTF, TTC, PFA, PFB, PCF, OTF, TEX, CNF, CFG, DEF, DAT, LDF, FD, ENC, MAP, VF, VPL, CLO, BUG, BUG2)- sync with upstream - install texlive.tlpdb for autodep finder- sync with upstream as of 15th Dec - fix dangling symlink (thanks to Michel Alexandre Salim)- temporarily disable dvi2tty because of failing test suite - package /etc/texmf and point texmf-config there- make release package part of the main build- texlive-jadetex-bin obsoletes jadetex- fix symlinks in /usr/bin so that they are not pointing to wrong location- sync with the latest TL2010 sources - don't make redundant copies of binaries, symlink them - fix symlinks to perl utilities- add obsolete of dvisvgm to allow smooth updates- fix file attributes and rpmlint warnings - define libdir when calling configure - rebuild against new poppler- move all the licenses and base directory hierarchy to texlive-base noarch subpackage - add automatic licensing code- sync with upstream (introducing mptopdf) - compile C source with -fno-strict-aliasing- switch to "tlpretest" source tree - add lua and ruby dependencies to packages requiring them - generate global package database "texlive.tlpdb" directly from tlpobj files shipped with each package- disable chktex so that build passes - fix dist tags in releases in binary packages- add dependencies resolution among biblatex files - another %postun scriptlets fix- add Requires(posttrans) to the main package- bump version of binaries because of the kpathsea soname increase- sync with upstream, remove ptex stuff for now- use 2010 prefix - do not ship/build asymptote (#548761)- declare fmutil.cnf, updmap.cfg, context.cnf and texmf.cnf as config files so that they don't get overwritten with texlive-kpathsea update - move man and info pages to the main packages, not -doc- blacklist a4wide.sty because of bad (noinfo) license- install man and info pages into proper locations visible by man and info - update scriptlets - remove xindy bits- update to oficcially released TeX Live 2009 - enable large file support- remove postun scriptlet to avoid accidential removal of texmf bits when not removing the package- tighten kpathsea devel dependency- fix generation of packages that ships only documentation - fix versioning of packages without version but with revision - fix heuristics for gathering .sty files dependencies - include packages under GFSL license - make files in old texmf tree from previous installs visible - do not obsolete old kpathsea, try to coexist - remove dvipdfm, dvipdfmx,depend of Fedora ones- TL2007 compatibility fixes: - create /usr/share/texmf symlink - clean all in post scriptlets- fix kpathsea Provides/Obsoletes- sync with latest upstream- make kpathsea independent on the main texlive package- remove packages under GFSL non-free license (tex-gyre)- fix dependencies to hyphenation packages - fix provides/obsoletes- require recommended LaTeX bits, the installation of pure scheme-basic is too minimalistic- require system psutils and t1utils and don't build the TL ones - correctly obsolete old kpathsea - binaries now have -bin postfix - support for Fedora fonts- add tetex-* virtual provides - fix unversioned requires - filter out unwanted libs and utilities from source- update to TeX Live 2009 - pretest- update to today's svn sources of binaries from upstream - fix directory -> symlink conversion - add ly1 (#488651)- initial packaging for TeX Live 2008 - wrote tl2rpm.c to autogenerate packages and post scriptlets from TeX Live metadata - fix kpathsea default search path 4:svn27129.1.8-12.fc22texlive-fancytooltips-doclppl1.2.txtcite.pngfancy-preview-demo.pdffancy-preview-demo.sin.tablefancy-preview-demo.texfancy-preview-demo2.pdffancy-preview-demo2.texfancytooltips-example.pdffancytooltips-example.textecna2.pdftooltipy.pdftooltipy.textooltipy.tipsreadmefancy-previewfancytipmark1.pdffancytipmark2.pdffancytipmark3.pdffancytipmark4.pdffancytooltips.pdfreadmetip.pdftip.tex/usr/share/doc//usr/share/doc/texlive-fancytooltips-doc//usr/share/texlive/texmf-dist/doc/latex/fancytooltips//usr/share/texlive/texmf-dist/doc/latex/fancytooltips/examples//usr/share/texlive/texmf-dist/doc/latex/fancytooltips/examples/pics/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -march=armv7-a -mfpu=vfpv3-d16 -mfloat-abi=harddrpmxz2armv7hl-redhat-linux-gnueabi?7zXZ !#,\]"k%6FlyZYy jK>Em ]BLMX슆 fA\ƣemtyQB'fx X AnZݶd.FoR; y%s\C/-F`Faup;bh`1BPew]L A%)t2p/gy6)|R s0)2jH;DqCI2uz8xYL~>tSa~ nLr⒘a݂~j\j,,IEJ;20 'Z/>Iwc#֯S;܃[rx _kH@{59^ y |oDs@5r>z:vl+2^>ߠSFAo96Ίs  @;ږKB cbn/Ѽdf=7t#$_A''z (YRw"}>b;"&*:Rwn:SըW\\]g'ʼnۏx))8c< 0Xj6 nonXd[3&}"0։(dVq\n(̪X06r*w )]DHx3n1( / kntկ<>ąo(q xp\ !dBCjYC-vUkpk9R^r3>8XbW PL$#v=!oqb'Gow*ӛ^gBh[~ė9wI,~475blQDY"&Y?sw8h;'f&c|e94N0t7#Xc,xQʄ)rךb:iKqw)gbY ɜF/Eֵ j_" Hӡ0FX y16ֺZ\Yf|g?e[aÙY9/zJ)]=oE-]gl!iqb0_)O;ҾДk x q9!f QS.uyl|%GxjaUTL=O!9u [-.nm$e T0t;~3gG^NMLflq%f&p`@sNOY P{Un$S/b\EsX5P6|2wC